![Western Blot: TBC1D5 Antibody [NBP1-93653] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.](http://images.novusbio.com/fullsize/TBC1D5-Antibody-Western-Blot-NBP1-93653-img0006.jpg "Western Blot: TBC1D5 Antibody [NBP1-93653] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: DVKRTFPEMQFFQQENVRKILTDVLFCYARENEQLLYKQGMHELLAPIVFVLHCDHQAFLHASESAQPSEEMKTVLNPEYLEHDAYAVFSQL |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | TBC1D5 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![CD300c Antibody [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "CD300c Antibody [Unconjugated]")
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | TBC1D5 |
![Immunohistochemistry-Paraffin: TBC1D5 Antibody [NBP1-93653] - Staining of human stomach shows moderate cytoplasmic positivity in parietal cells.](http://images.novusbio.com/fullsize/TBC1D5-Antibody-Immunohistochemistry-Paraffin-NBP1-93653-img0001.jpg "Immunohistochemistry-Paraffin: TBC1D5 Antibody [NBP1-93653] - Staining of human stomach shows moderate cytoplasmic positivity in parietal cells.")
![Western Blot: TBC1D5 Antibody [NBP1-93653] - Analysis using Anti-TBC1D5 antibody NBP1-93653 (A) shows similar pattern to independent antibody NBP2-38237 (B).](http://images.novusbio.com/fullsize/TBC1D5-Antibody-Western-Blot-NBP1-93653-img0007.jpg "Western Blot: TBC1D5 Antibody [NBP1-93653] - Analysis using Anti-TBC1D5 antibody NBP1-93653 (A) shows similar pattern to independent antibody NBP2-38237 (B).")
![Immunohistochemistry Cathepsin D Antibody [Unconjugated]](https://images.novusbio.com/images2/Cathepsin_D_AF1029_Immunohistochemistry_6668.jpg)
![Immunocytochemistry Cathepsin D Antibody [Unconjugated]](https://images.novusbio.com/images2/Cathepsin_D_AF1029_Immunocytochemistry__Immunofluorescence_23054.jpg)
![Western Blot Cathepsin D Antibody [Unconjugated]](https://images.novusbio.com/images2/Cathepsin_D_AF1029_Western_Blot_19580.jpg)
![Immunocytochemistry RUNX3/CBFA3 Antibody (527327) [Unconjugated]](https://images.novusbio.com/images2/RUNX3_MAB3765_Immunocytochemistry_10636.jpg)
![Western Blot RUNX3/CBFA3 Antibody (527327) [Unconjugated]](https://images.novusbio.com/images2/RUNX3_MAB3765_Western_Blot_10662.jpg)
![Simple Western RUNX3/CBFA3 Antibody (527327) [Unconjugated]](https://images.novusbio.com/images2/16364.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")