![Immunohistochemistry-Paraffin: SYT7 Antibody [NBP1-81588] - Staining in human cerebral cortex and skeletal muscle tissues . Corresponding SYT7 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/SYT7-Antibody-Immunohistochemistry-Paraffin-NBP1-81588-img0014.jpg "Immunohistochemistry-Paraffin: SYT7 Antibody [NBP1-81588] - Staining in human cerebral cortex and skeletal muscle tissues . Corresponding SYT7 RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: NSLETVGTPDSGRGRSEKKAIKLPAGGKAVNTAPVPGQTPHDESDRRTEPRSSVSDLVNSLTSEMLMLSPGSEEDEAHEGCSRENLGRIQFSVGYNFQESTLTVKIMKAQELPAKDFSGTSDPFVKIYLLP |
| Predicted Species | Mouse (98%), Rat (98%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SYT7 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for SYT7 Antibody (NBP1-81588)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SYT7 |
![Western Blot: SYT7 Antibody [NBP1-81588] - Analysis in control (vector only transfected HEK293T lysate) and SYT7 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize/SYT7-Antibody-Western-Blot-NBP1-81588-img0015.jpg "Western Blot: SYT7 Antibody [NBP1-81588] - Analysis in control (vector only transfected HEK293T lysate) and SYT7 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).")
![Western Blot: SYT7 Antibody [NBP1-81588] - Analysis in human cell line SK-BR-3.](http://images.novusbio.com/fullsize/SYT7-Antibody-Western-Blot-NBP1-81588-img0009.jpg "Western Blot: SYT7 Antibody [NBP1-81588] - Analysis in human cell line SK-BR-3.")
![Immunohistochemistry-Paraffin: SYT7 Antibody [NBP1-81588] - Staining of human cerebellum shows moderate to strong cytoplasmic positivity in purkinje cells.](http://images.novusbio.com/fullsize/SYT7-Antibody-Immunohistochemistry-Paraffin-NBP1-81588-img0010.jpg "Immunohistochemistry-Paraffin: SYT7 Antibody [NBP1-81588] - Staining of human cerebellum shows moderate to strong cytoplasmic positivity in purkinje cells.")
![Immunohistochemistry-Paraffin: SYT7 Antibody [NBP1-81588] - Staining of human cerebral cortex shows strong positivity in neuropil.](http://images.novusbio.com/fullsize/SYT7-Antibody-Immunohistochemistry-Paraffin-NBP1-81588-img0011.jpg "Immunohistochemistry-Paraffin: SYT7 Antibody [NBP1-81588] - Staining of human cerebral cortex shows strong positivity in neuropil.")
![Immunohistochemistry-Paraffin: SYT7 Antibody [NBP1-81588] - Staining of human prostate shows moderate to strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/SYT7-Antibody-Immunohistochemistry-Paraffin-NBP1-81588-img0012.jpg "Immunohistochemistry-Paraffin: SYT7 Antibody [NBP1-81588] - Staining of human prostate shows moderate to strong cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: SYT7 Antibody [NBP1-81588] - Staining of human skeletal muscle shows no cytoplasmic positivity in myocytes as expected.](http://images.novusbio.com/fullsize/SYT7-Antibody-Immunohistochemistry-Paraffin-NBP1-81588-img0013.jpg "Immunohistochemistry-Paraffin: SYT7 Antibody [NBP1-81588] - Staining of human skeletal muscle shows no cytoplasmic positivity in myocytes as expected.")
![Immunocytochemistry Synaptotagmin 1 Antibody (ASV48) [Unconjugated]](https://images.novusbio.com/images2/Synaptotagmin-1_MAB4364_Immunocytochemistry_11323.jpg)
![Immunohistochemistry Synaptotagmin 1 Antibody (ASV48) [Unconjugated]](https://images.novusbio.com/images2/Synaptotagmin-1_MAB4364_Immunohistochemistry_7025.jpg)
![Immunocytochemistry Synaptotagmin 1 Antibody (ASV48) [Unconjugated]](https://images.novusbio.com/images2/Synaptotagmin1_MAB4364_Immunocytochemistry_13008.jpg)
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Bioactivity CTLA-4 [Unconjugated]](https://images.novusbio.com/images2/CTLA4_7268CT_2293.jpg)
![Immunocytochemistry Glucagon Antibody (181402) [Unconjugated]](https://images.novusbio.com/images2/Glucagon_MAB1249_Immunocytochemistry_6560.jpg)
![Intracellular Staining by Flow Cytometry Glucagon Antibody (181402) [Unconjugated]](https://images.novusbio.com/images2/Glucagon_MAB1249_Flow_Cytometry_20264.jpg)
![Complement Component C2 Antibody [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "Complement Component C2 Antibody [Unconjugated]")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")