![Western Blot: STX17 Antibody [NBP1-93968] - Analysis in A-431 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-STX17 antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB.](http://images.novusbio.com/fullsize/STX17-Antibody-Western-Blot-NBP1-93968-img0012.jpg "Western Blot: STX17 Antibody [NBP1-93968] - Analysis in A-431 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-STX17 antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB.")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | WB, Simple Western, ICC/IF, IHC, IP, KD |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: RLEPAIQKFIKIVIPTDLERLRKHQINIEKYQRCRIWDKLHEEHINAGRTVQQLRSNIREIEKLCLKVRKDDLVLLKRMIDPVKEEASAATAEFLQLHLESVEELKKQFNDEETLLQPPLTRSMTVGGAFHTTEAEASSQSLTQ |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | STX17 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Bioactivity ASIP [Unconjugated]](https://images.novusbio.com/images2/ASIP_9094AG_1188.jpg)
![Simple Western Syntaxin 5 Antibody [Unconjugated]](https://images.novusbio.com/images2/Syntaxin_5_AF5687_Simple_Western_20944.jpg)
![Western Blot Syntaxin 5 Antibody [Unconjugated]](https://images.novusbio.com/images2/Syntaxin_5_AF5687_Western_Blot_5806.jpg)
![Immunohistochemistry Syntaxin 5 Antibody [Unconjugated]](https://images.novusbio.com/images2/Syntaxin_5_AF5687_Immunohistochemistry_19570.jpg)
![Intracellular Staining by Flow Cytometry IL-17C Antibody (177114) [Unconjugated]](https://images.novusbio.com/images2/IL-17C_MAB1234_Flow_Cytometry_8330.jpg)
![Immunohistochemistry IL-17C Antibody (177114) [Unconjugated]](https://images.novusbio.com/images2/IL17C_MAB1234_Immunohistochemistry_20070.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for STX17 Antibody (NBP1-93968)Find related products by research area.
|
|
Read full blog post. |
|
Autophagy independent roles of the core ATG proteins By Christina Towers, PhD. Autophagy and ATG ProteinsAutophagy is a nutrient recycling process that cells use to fuel metabolism, particularly in response to nutrient deprivation. It is critical for removal of dam... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | STX17 |
![Immunohistochemistry: STX17 Antibody [NBP1-93968] - Immunohistochemical detection of STX17 in liver tissue. After fixation in neutral buffered formalin for 24 h, liver samples of wild type mice were paraffin-embedded and stained for STX17 using rabbit polyclonal anti-STX17 (Novus Biologicals, Littleton, CO, USA; NBP1-93968). Heat-mediated antigen retrieval was performed in citrate buffer (pH 6.0). An accumulation of STX17-positive dots is detectable after starvation. Scale bar = 20 um. Image collected and cropped by CiteAb from the following publication (//www.mdpi.com/2073-4409/6/3/17), licensed under a CC-BY license.](http://images.novusbio.com/fullsize/STX17-Antibody-Immunohistochemistry-NBP1-93968-img0013.jpg "Immunohistochemistry: STX17 Antibody [NBP1-93968] - Immunohistochemical detection of STX17 in liver tissue. After fixation in neutral buffered formalin for 24 h, liver samples of wild type mice were paraffin-embedded and stained for STX17 using rabbit polyclonal anti-STX17 (Novus Biologicals, Littleton, CO, USA; NBP1-93968). Heat-mediated antigen retrieval was performed in citrate buffer (pH 6.0). An accumulation of STX17-positive dots is detectable after starvation. Scale bar = 20 um. Image collected and cropped by CiteAb from the following publication (//www.mdpi.com/2073-4409/6/3/17), licensed under a CC-BY license.")
![Immunohistochemistry-Paraffin: STX17 Antibody [NBP1-93968] - Immunohistochemical staining of human skin shows moderate cytoplasmic positivity in epidermal cells.](http://images.novusbio.com/fullsize/STX17-Antibody-Immunohistochemistry-Paraffin-NBP1-93968-img0008.jpg "Immunohistochemistry-Paraffin: STX17 Antibody [NBP1-93968] - Immunohistochemical staining of human skin shows moderate cytoplasmic positivity in epidermal cells.")
![Immunohistochemistry-Paraffin: STX17 Antibody [NBP1-93968] - Immunohistochemical staining of human endometrium shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/STX17-Antibody-Immunohistochemistry-Paraffin-NBP1-93968-img0009.jpg "Immunohistochemistry-Paraffin: STX17 Antibody [NBP1-93968] - Immunohistochemical staining of human endometrium shows strong cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: STX17 Antibody [NBP1-93968] - Immunohistochemical staining of human prostate shows moderate cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/STX17-Antibody-Immunohistochemistry-Paraffin-NBP1-93968-img0010.jpg "Immunohistochemistry-Paraffin: STX17 Antibody [NBP1-93968] - Immunohistochemical staining of human prostate shows moderate cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: STX17 Antibody [NBP1-93968] - Immunohistochemical staining of human duodenum shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/STX17-Antibody-Immunohistochemistry-Paraffin-NBP1-93968-img0011.jpg "Immunohistochemistry-Paraffin: STX17 Antibody [NBP1-93968] - Immunohistochemical staining of human duodenum shows strong cytoplasmic positivity in glandular cells.")
![Simple Western: STX17 Antibody [NBP1-93968] - Simple Western lane view shows a specific band for STX17 in 0.2 mg/ml of RT-4 (left) and U-251MG sp (right) lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.](http://images.novusbio.com/fullsize/STX17-Antibody-Simple-Western-NBP1-93968-img0006.jpg "Simple Western: STX17 Antibody [NBP1-93968] - Simple Western lane view shows a specific band for STX17 in 0.2 mg/ml of RT-4 (left) and U-251MG sp (right) lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.")
![Simple Western: STX17 Antibody [NBP1-93968] - Electropherogram image(s) of corresponding Simple Western lane view. STX17 antibody was used at 1:30 dilution on RT-4 and U-251MG sp lysates(s).](http://images.novusbio.com/fullsize/STX17-Antibody-Simple-Western-NBP1-93968-img0007.jpg "Simple Western: STX17 Antibody [NBP1-93968] - Electropherogram image(s) of corresponding Simple Western lane view. STX17 antibody was used at 1:30 dilution on RT-4 and U-251MG sp lysates(s).")
![Bioactivity CTLA-4 [Unconjugated]](https://images.novusbio.com/images2/CTLA4_7268CT_2293.jpg)
![Western Blot VAMP-8 Antibody [Unconjugated]](https://images.novusbio.com/images2/VAMP-8_AF5354_Western_Blot_5695.jpg)
![Immunohistochemistry VAMP-8 Antibody [Unconjugated]](https://images.novusbio.com/images2/VAMP8_AF5354_Immunohistochemistry_19693.jpg)
![N/A IL-13 [Biotin]](https://images.novusbio.com/images2/DATA_IL13_DY413_ELISA_2010.jpg)
![Immunocytochemistry IL-21 Antibody [Unconjugated]](https://images.novusbio.com/images2/IL-21_AF594_Immunocytochemistry_6525.jpg)
![Neutralization IL-21 Antibody [Unconjugated]](https://images.novusbio.com/images2/af594_mouse-il-21-affinity-purified-polyclonal-ab-neutralization-249202192915.jpg)
![N/A CD25/IL-2R alpha [HRP]](https://images.novusbio.com/images2/IL-2_R_alpha_DR2A00_ELISA_167.jpg)
![N/A CD25/IL-2R alpha [HRP]](https://images.novusbio.com/images2/DATA_CD25_DR2A00_ELISA_800.jpg)
![Bioactivity IL-2 [Unconjugated]](https://images.novusbio.com/images/202-il_recombinant-human-il-2-protein-bioactivity-174202314946.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/DATA_IL6_M6000_ELISA_936.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/IL-6_M6000_ELISA_415.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images/m6000b_mouse-il-6-quantikine-elisa-kit-44202415433118.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")