Stathmin 1 Antibody - BSA Free Summary
Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 1-149 of human Stathmin 1 (NP_981944.1). MASSDIQVKELEKRASGQAFELILSPRSKESVPEFPLSPPKKKDLSLEEIQKKLEAAEERRKSHEAEVLKQLAEKREHEKEVLQKAIEENNNFSKMAEEKLTHKMEANKENREAQMAAKLERLREKDKHIEEVRKNKESKDPADETEAD |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
STMN1 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Western Blot 1:500 - 1:2000
|
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.3), 50% glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Affinity purified |
Alternate Names for Stathmin 1 Antibody - BSA Free
Background
Stathmin (oncoprotein 18, op18) is a ubiquitous cytosolic phosphoprotein with various regulatory functions in cell proliferation, differentiation signaling, and activation (1). In particular, stathmin is involved in the regulation of tubulin dynamics through inhibition of microtubule formation and/or microtubule depolymerization. Stathmin interacts with soulable tubulins (alpha,beta-tubulin) resulting in the formation of T2S complex which sequesters free tubulin, impeding tubulin formation (2). Stathmin activity is regulated through phosphorylation at Ser16, Ser25, Ser38 and Ser63 by various protein kinases (e.g. MAP-kinase, p34cdc2 kinase), weakening stathmin's affinity to tubulin (3). A mutation on stathmin can lead to excess build up of mitotic spindle and with possible consequence of unregulated cell cycles seen in cancer cells (4). Stathmin is also known as the generic member of a protein family which includes neural proteins SCG10, SCLIP and RB3/RB3/RB3. All members in this family exhibits tubulin binding ability.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Pm, Rt, Xp, Ze
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC-WhMt, IHC, IHC-Fr, IHC-P, In vitro, In vivo, KD, WB
Species: Ec, Hu
Applications: ELISA, ICC/IF, IM, IP, PAGE, WB
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, RIA, WB
Species: Hu
Applications: BA
Species: Hu
Applications: CyTOF-ready, ICFlow, WB
Species: Mu, Rt
Applications: WB
Species: Hu, Rt
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, WB
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: WB
Publications for Stathmin 1 Antibody (NBP2-94766) (0)
There are no publications for Stathmin 1 Antibody (NBP2-94766).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Stathmin 1 Antibody (NBP2-94766) (0)
There are no reviews for Stathmin 1 Antibody (NBP2-94766).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Stathmin 1 Antibody (NBP2-94766) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Stathmin 1 Products
Research Areas for Stathmin 1 Antibody (NBP2-94766)
Find related products by research area.
|
Blogs on Stathmin 1