![Immunohistochemistry-Paraffin: SP140 Antibody [NBP1-81275] - Staining of human small intestine shows strong nuclear positivity in lymphoid cells.](http://images.novusbio.com/fullsize/SP140-Antibody-Immunohistochemistry-Paraffin-NBP1-81275-img0006.jpg "Immunohistochemistry-Paraffin: SP140 Antibody [NBP1-81275] - Staining of human small intestine shows strong nuclear positivity in lymphoid cells.")
| Reactivity | HuSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: SELEKTFGWSHLEALFSRINLMAYPDLNEIYRSFQNVCYEHSPLQMNNVNDLEDRPRLLPYGKQENSNACHEMDDIAVPQEALSSSPRCEPGFSSESCEQLALPKAGGGDAEDAPSLLPGGGVSCKLAIQIDEGESEEMPKLLP |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SP140 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SP140 |
![Immunohistochemistry-Paraffin: SP140 Antibody [NBP1-81275] - Staining of human lymph node shows strong nuclear positivity in lymphoid cells.](http://images.novusbio.com/fullsize/SP140-Antibody-Immunohistochemistry-Paraffin-NBP1-81275-img0003.jpg "Immunohistochemistry-Paraffin: SP140 Antibody [NBP1-81275] - Staining of human lymph node shows strong nuclear positivity in lymphoid cells.")
![Immunohistochemistry-Paraffin: SP140 Antibody [NBP1-81275] - Staining of human pancreas shows no nuclear positivity in exocrine glandular cells as expected.](http://images.novusbio.com/fullsize/SP140-Antibody-Immunohistochemistry-Paraffin-NBP1-81275-img0004.jpg "Immunohistochemistry-Paraffin: SP140 Antibody [NBP1-81275] - Staining of human pancreas shows no nuclear positivity in exocrine glandular cells as expected.")
![Immunohistochemistry-Paraffin: SP140 Antibody [NBP1-81275] - Staining of human placenta shows strong nuclear positivity in lymphoid cells.](http://images.novusbio.com/fullsize/SP140-Antibody-Immunohistochemistry-Paraffin-NBP1-81275-img0005.jpg "Immunohistochemistry-Paraffin: SP140 Antibody [NBP1-81275] - Staining of human placenta shows strong nuclear positivity in lymphoid cells.")
![Immunohistochemistry-Paraffin: SP140 Antibody [NBP1-81275] - Staining in human lymph node and pancreas tissues . Corresponding SP140 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/SP140-Antibody-Immunohistochemistry-Paraffin-NBP1-81275-img0007.jpg "Immunohistochemistry-Paraffin: SP140 Antibody [NBP1-81275] - Staining in human lymph node and pancreas tissues . Corresponding SP140 RNA-seq data are presented for the same tissues.")
![Western Blot HAI-1/HGFA Inhibitor 1 Antibody [Unconjugated]](https://images.novusbio.com/images2/HAI1_AF1048_Western_Blot_16818.jpg)
![Immunohistochemistry HAI-1/HGFA Inhibitor 1 Antibody [Unconjugated]](https://images.novusbio.com/images2/HAI1_AF1048_Immunohistochemistry_18061.jpg)
![Simple Western HAI-1/HGFA Inhibitor 1 Antibody [Unconjugated]](https://images.novusbio.com/images2/HAI1_AF1048_Simple_Western_18675.jpg)
![Western Blot IRF1 Antibody [Unconjugated]](https://images.novusbio.com/images2/IRF1_AF4715_Western_Blot_5529.jpg)
![Western Blot IRF1 Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af4715_mouse-irf1-affinity-purified-polyclonal-ab-western-blot-16122024101037..png)
![DAN/NBL1 Antibody [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "DAN/NBL1 Antibody [Unconjugated]")
![Immunohistochemistry Galectin-4 Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af2128_mouse-galectin-4-affinity-purified-polyclonal-ab-immunohistochemistry-29122022154254.jpg)
![Knockout Validated Isocitrate Dehydrogenase 1/IDH1 Antibody (843219) [Unconjugated]](https://images.novusbio.com/images2/Isocitrate_Dehydrogenase_1_MAB7049_Knockout_Validated_22540.jpg)
![Immunocytochemistry Isocitrate Dehydrogenase 1/IDH1 Antibody (843219) [Unconjugated]](https://images.novusbio.com/images2/Isocitrate_Dehydrogenase_1_MAB7049_Immunocytochemistry__Immunofluorescence_19067.jpg)
![Western Blot Isocitrate Dehydrogenase 1/IDH1 Antibody (843219) [Unconjugated]](https://images.novusbio.com/images2/Isocitrate_Dehydrogenase_1_MAB7049_Western_Blot_13853.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")