![Western Blot: DRIL1 Antibody (1A11) [H00001820-M01] - ARID3A monoclonal antibody (M01), clone 1A11 Analysis of ARID3A expression in K-562.](http://images.novusbio.com/fullsize/DRIL1-Antibody-1A11-Western-Blot-H00001820-M01-img0013.jpg "Western Blot: DRIL1 Antibody (1A11) [H00001820-M01] - ARID3A monoclonal antibody (M01), clone 1A11 Analysis of ARID3A expression in K-562.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA, ICC/IF, IHC, KD |
| Clone | 1A11 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Description | Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen | ARID3A (NP_005215, 317 a.a. ~ 416 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QYMKYLYPYECEKRGLSNPNELQAAIDSNRREGRRQSFGGSLFAYSPGGAHGMLSSPKLPVSSLGLAASTNGSSITPAPKIKKEEDSAIPITVPGRLPVS |
| Specificity | ARID3A - AT rich interactive domain 3A (BRIGHT- like) |
| Isotype | IgG1 Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | ARID3A |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | Antibody reactivity against recominant protein and cell lysate for WB. It has been used for IF, IHC-P, RNAi Validation and ELISA. |
|
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
![Western Blot PAK3 Antibody [Unconjugated]](https://images.novusbio.com/images2/PAK3_AF6897_Western_Blot_11082.jpg)
![Immunohistochemistry PAK3 Antibody [Unconjugated]](https://images.novusbio.com/images2/PAK3_AF6897_Immunohistochemistry_11144.jpg)
![Immunohistochemistry PAK3 Antibody [Unconjugated]](https://images.novusbio.com/images2/PAK3_AF6897_Immunohistochemistry_11480.jpg)
| Publication using H00001820-M01 | Applications | Species |
|---|---|---|
| Kang UB, Yeom J, Kim HJ et al. Expression profiling of more than 3500 proteins of MSS-type colorectal cancer by stable isotope labeling and mass spectrometry. J Proteomics. 2011-12-26 [PMID: 22154799] |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: DRIL1 Antibody (1A11) [H00001820-M01] - Analysis of monoclonal antibody to ARID3A on HeLa cell. Antibody concentration 10 ug/ml.](http://images.novusbio.com/fullsize/DRIL1-Antibody-1A11-Immunocytochemistry-Immunofluorescence-H00001820-M01-img0009.jpg "Immunocytochemistry/Immunofluorescence: DRIL1 Antibody (1A11) [H00001820-M01] - Analysis of monoclonal antibody to ARID3A on HeLa cell. Antibody concentration 10 ug/ml.")
![Immunohistochemistry-Paraffin: DRIL1 Antibody (1A11) [H00001820-M01] - Analysis of monoclonal antibody to ARID3A on formalin-fixed paraffin-embedded human placenta. Antibody concentration 3 ug/ml.](http://images.novusbio.com/fullsize/DRIL1-Antibody-1A11-Immunohistochemistry-Paraffin-H00001820-M01-img0011.jpg "Immunohistochemistry-Paraffin: DRIL1 Antibody (1A11) [H00001820-M01] - Analysis of monoclonal antibody to ARID3A on formalin-fixed paraffin-embedded human placenta. Antibody concentration 3 ug/ml.")
![Western Blot: DRIL1 Antibody (1A11) [H00001820-M01] - analysis of ARID3A expression in transfected 293T cell line by ARID3A monoclonal antibody (M01), clone 1A11. Lane 1: ARID3A transfected lysate (63 KDa). Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/DRIL1-Antibody-1A11-Western-Blot-H00001820-M01-img0001.jpg "Western Blot: DRIL1 Antibody (1A11) [H00001820-M01] - analysis of ARID3A expression in transfected 293T cell line by ARID3A monoclonal antibody (M01), clone 1A11. Lane 1: ARID3A transfected lysate (63 KDa). Lane 2: Non-transfected lysate.")
![Western Blot: DRIL1 Antibody (1A11) [H00001820-M01] - Analysis of ARID3A over-expressed 293 cell line, cotransfected with ARID3A Validated Chimera RNAi ( Cat # H00001820-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with ARID3A monoclonal antibody (M01), clone 1A11 (Cat # H00001820-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.](http://images.novusbio.com/fullsize/DRIL1-Antibody-1A11-Western-Blot-H00001820-M01-img0012.jpg "Western Blot: DRIL1 Antibody (1A11) [H00001820-M01] - Analysis of ARID3A over-expressed 293 cell line, cotransfected with ARID3A Validated Chimera RNAi ( Cat # H00001820-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with ARID3A monoclonal antibody (M01), clone 1A11 (Cat # H00001820-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.")
![ELISA: DRIL1 Antibody (1A11) [H00001820-M01] - Detection limit for recombinant GST tagged ARID3A is approximately 0.03ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/DRIL1-Antibody-1A11-ELISA-H00001820-M01-img0007.jpg "ELISA: DRIL1 Antibody (1A11) [H00001820-M01] - Detection limit for recombinant GST tagged ARID3A is approximately 0.03ng/ml as a capture antibody.")
![Immunohistochemistry BTK [p Tyr223] Antibody - BSA Free](https://images.novusbio.com/images/BTK-[p-Tyr223]-Antibody-Immunohistochemistry-NBP1-78295-img0002.jpg)
![Western Blot BTK [p Tyr223] Antibody - BSA Free](https://images.novusbio.com/images/BTK-[p-Tyr223]-Antibody-Western-Blot-NBP1-78295-img0004.jpg)
![Neutralization TRAILR1/TNFRSF10A Antibody [Unconjugated]](https://images.novusbio.com/images2/TRAIL_R1_AF347_Block_Neutralize_875.jpg)
![Western Blot TRAILR1/TNFRSF10A Antibody [Unconjugated]](https://images.novusbio.com/images2/TRAIL_R1_AF347_Western_Blot_5303.jpg)
![Immunohistochemistry TRAILR1/TNFRSF10A Antibody [Unconjugated]](https://images.novusbio.com/images2/TRAIL_R1_AF347_Immunohistochemistry_17355.jpg)
![Western Blot IRF1 Antibody [Unconjugated]](https://images.novusbio.com/images2/IRF1_AF4715_Western_Blot_5529.jpg)
![Western Blot IRF1 Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af4715_mouse-irf1-affinity-purified-polyclonal-ab-western-blot-16122024101037..png)
![Western Blot RB1 Antibody (607121) [Unconjugated]](https://images.novusbio.com/images2/RB1_MAB6495_Western_Blot_10216.jpg)
![Immunocytochemistry RB1 Antibody (607121) [Unconjugated]](https://images.novusbio.com/images2/RB1_MAB6495_Immunocytochemistry_10464.jpg)
![Simple Western RB1 Antibody (607121) [Unconjugated]](https://images.novusbio.com/images2/RB1_MAB6495_Simple_Western_16629.jpg)
![Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.](https://images.novusbio.com/images/Mouse-IgG1-Kappa-Light-Chain-Isotype-Control-P3-6-2-8-1-Flow-Cytometry-NBP1-43319-img0002.jpg "Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.")