Home » SOX11 » SOX11 Proteins » SOX11 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

SOX11 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for SOX11 Recombinant Protein Antigen (NBP2-52865PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

SOX11 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SOX11.

Source: E. coli

Amino Acid Sequence: FMVWSKIERRKIMEQSPDMHNAEISKRLGKRWKMLKDSEKIPFIREAERLRLKHMADYPDYKYRPRKKPKMDPSAKPSASQSPEKSAAGGGGGSAGGGAGGAKTSKGSSKK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SOX11
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52865.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking tide related information and a protocol, click here.
Theoretical MW
30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SOX11 Recombinant Protein Antigen

  • SOX11
  • SRY (sex determining region Y)-box 11
  • SRY (sex-determining region Y)-box 11
  • SRY-related HMG-box gene 11
  • transcription factor SOX-11

Background

SOX11 encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. The protein may function in the developing nervous system and play a role in tumorigenesis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

SOX4 Antibody
(CL5665)
NBP2-61421
Immunohistochemistry-Paraffin SOX4 Antibody (CL5665)
Immunohistochemistry-Paraffin SOX4 Antibody (CL5665)
Immunocytochemistry/ Immunofluorescence SOX4 Antibody (CL5665)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
Cyclin D1 Antibody
(SPM587)
NBP2-32840
Western Blot Cyclin D1 Antibody (SPM587)
Flow Cytometry Cyclin D1 Antibody (SPM587)
Flow Cytometry Cyclin D1 Antibody (SPM587)
(1 Review)
(9 Publications)
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
SOX2 Antibody
[Unconjugated]
AF2018
Western Blot SOX2 Antibody [Unconjugated]
Chromatin Immunoprecipitation (ChIP) SOX2 Antibody [Unconjugated]
Simple Western SOX2 Antibody [Unconjugated]
(6 Reviews)
(364 Publications)
Species: Hu, Mu, Rt
Applications: ChIP, ICC, IHC, Simple Western, WB
SOX9 Antibody
[Unconjugated]
AF3075
Immunocytochemistry SOX9 Antibody [Unconjugated]
Western Blot SOX9 Antibody [Unconjugated]
Immunocytochemistry SOX9 Antibody [Unconjugated]
(2 Reviews)
(153 Publications)
Species: Hu
Applications: ICC, Simple Western, WB
SOX3 Antibody
[Unconjugated]
AF2569
Immunocytochemistry SOX3 Antibody [Unconjugated]
Immunocytochemistry SOX3 Antibody [Unconjugated]
(13 Publications)
Species: Hu
Applications: ICC, WB
SRY Antibody (1G4)
- BSA Free
NBP2-37463
ELISA SRY Antibody (1G4) - BSA Free
Western Blot SRY Antibody (1G4) - BSA Free
Western Blot SRY Antibody (1G4) - BSA Free
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, WB
SOX15 Antibody
[Unconjugated]
AF4070
Western Blot SOX15 Antibody [Unconjugated]
Immunocytochemistry SOX15 Antibody [Unconjugated]
Immunocytochemistry SOX15 Antibody [Unconjugated]
(1 Publication)
Species: Hu
Applications: ICC, WB
Recombinant Human
SOX22 GST (N-Term) Pr ...
H00006666-Q01
SDS-PAGE Recombinant Human SOX22 GST (N-Term) Protein
(1 Publication)
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Fumarase Antibody
NBP1-31336
Western Blot Fumarase Antibody
Western Blot Fumarase Antibody
Immunocytochemistry/ Immunofluorescence Fumarase Antibody
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
CLEC4D/CLECSF8
Antibody (413512)
MAB2806
Flow Cytometry CLEC4D/CLECSF8 Antibody (413512)
(2 Publications)
Species: Hu
Applications: CyTOF-ready, Flow, WB
SOX10 Antibody
[Unconjugated]
AF2864
Immunocytochemistry SOX10 Antibody [Unconjugated]
Immunocytochemistry SOX10 Antibody [Unconjugated]
Immunohistochemistry SOX10 Antibody [Unconjugated]
(2 Reviews)
(116 Publications)
Species: Hu
Applications: ICC, IHC, WB
p53 Antibody (PAb
240) - BSA Free
NB200-103
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow (Intracellular) p53 Antibody (PAb 240) - BSA Free
(3 Reviews)
(42 Publications)
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
TEAD2 Antibody -
BSA Free
NBP2-94220
Western Blot TEAD2 Antibody - BSA Free
Western Blot TEAD2 Antibody - BSA Free
Western Blot TEAD2 Antibody - BSA Free
Species: Hu
Applications: ELISA, WB
SOX5 Antibody
AF5286
Western Blot SOX5 Antibody
(1 Publication)
Species: Hu
Applications: WB
POU3F3 Antibody
NBP1-49872
Western Blot POU3F3 Antibody
Immunocytochemistry/ Immunofluorescence POU3F3 Antibody
Flow Cytometry POU3F3 Antibody
(1 Review)
(9 Publications)
Species: Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, PEP-ELISA, WB
SOX21 Antibody
[Unconjugated]
AF3538
Immunocytochemistry SOX21 Antibody [Unconjugated]
Immunohistochemistry SOX21 Antibody [Unconjugated]
(6 Publications)
Species: Hu
Applications: ICC, IHC, WB
ATF3 Antibody
NBP1-85816
Immunohistochemistry-Paraffin ATF3 Antibody
Immunohistochemistry-Paraffin ATF3 Antibody
Immunohistochemistry-Paraffin ATF3 Antibody
(3 Reviews)
(31 Publications)
Species: Fe, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, KO, WB
SOX8 Antibody
NBP3-12898
Western Blot SOX8 Antibody
Immunohistochemistry-Paraffin SOX8 Antibody
Immunocytochemistry/ Immunofluorescence SOX8 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
SOX1 Antibody
[Unconjugated]
AF3369
Western Blot SOX1 Antibody [Unconjugated]
Simple Western SOX1 Antibody [Unconjugated]
Immunocytochemistry SOX1 Antibody [Unconjugated]
(135 Publications)
Species: Hu, Mu, Rt
Applications: ICC, IHC, Simple Western, WB
SOX11 Recombinant
Protein Antigen
NBP2-52865PEP
SOX11 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for SOX11 Recombinant Protein Antigen (NBP2-52865PEP) (0)

There are no publications for SOX11 Recombinant Protein Antigen (NBP2-52865PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SOX11 Recombinant Protein Antigen (NBP2-52865PEP) (0)

There are no reviews for SOX11 Recombinant Protein Antigen (NBP2-52865PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for SOX11 Recombinant Protein Antigen (NBP2-52865PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SOX11 Products

Blogs on SOX11.

Check out the latest blog posts on SOX11.
SOX-11 seals your fate
The SOX-11 transcription factor is a member of the SOX family known to be involved in embryonic development regulation and cell fate determination. The protein acts as a transcriptional regulator and appears to modulate fundamental aspects of normal e...  Read full blog post.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Western blot shows lysates of D3 mouse embryonic stem cell line, NTera-2 human testicular embryonic carcinoma cell line, F9 mouse teratocarcinoma stem cells, and rat cortical stem cells. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human/Mouse/Rat SOX2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2018) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (HAF017). A specific band was detected for SOX2 at approximately 36 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
SOX2 Antibody [Unconjugated]
AF2018
SOX9 was detected in immersion fixed BG01V human embryonic stem cells differentiated into early proximal lung progenitor cells using Goat Anti-Human SOX9 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3075) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red, upper panel; NL001) and counterstained with DAPI (blue, lower panel). Specific staining was localized to nuclei. View our protocol for Fluorescent ICC Staining of Stem Cells on Coverslips.
SOX9 Antibody [Unconjugated]
AF3075

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SOX11 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol SOX11