Home » SOCS-7/Nck/NAP4 » Nck Peptides and Proteins » SOCS-7/Nck/NAP4 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

SOCS-7/Nck/NAP4 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for SOCS-7/Nck/NAP4 Protein (NBP2-13363PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

SOCS-7/Nck/NAP4 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SOCS7.

Source: E. coli

Amino Acid Sequence: LETNSCSEEELSSPGRGGGGGGRLLLQPPGPELPPVPFPLQDLVPLGRLSRGEQQQQQQQQPPPPPPPPGPLRPLAGPSRKGSFKIRLSRLFRTKSCNGGSGGGDGTGKRPSGELAASAASLTDMGGSAGRELDAGRKPKLTR

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SOCS7
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-13363.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SOCS-7/Nck/NAP4 Recombinant Protein Antigen

  • NAP4
  • NAP-4
  • NAP4SOCS-7
  • Nck
  • Nck, Ash and phospholipase C binding protein
  • Nck, Ash and phospholipase C gamma-binding protein
  • NCKAP4
  • Nck-associated protein 4
  • SOCS6
  • SOCS7
  • SOCS-7
  • suppressor of cytokine signaling 7

Background

Regulates signaling cascades probably through protein ubiquitination and/or sequestration. Functions in insulin signaling and glucose homeostasis through IRS1 ubiquitination and subsequent proteasomal degradation. Inhibits also prolactin, growth hormone and leptin signaling by preventing STAT3 and STAT5 activation, sequestering them in the cytoplasm and reducing their binding to DNA. May be a substrate recognition component of a SCF-like E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

CISH/CIS-1
Antibody [Unconjugate
AF3194
Western Blot CISH/CIS-1 Antibody [Unconjugated]
Immunocytochemistry CISH/CIS-1 Antibody [Unconjugated]
Simple Western CISH/CIS-1 Antibody [Unconjugated]
(1 Review)
(2 Publications)
Species: Hu
Applications: ICC, Simple Western, WB
SOCS-3 Antibody
(516919) [Unconjugate
MAB5696
Western Blot SOCS-3 Antibody (516919) [Unconjugated]
(6 Publications)
Species: Hu, Mu
Applications: WB
SOCS-1 Antibody
NB100-56637
Western Blot SOCS-1 Antibody
(1 Review)
(5 Publications)
Species: Hu, Mu
Applications: WB
SOCS-2 Antibody
(6D3F6)
NBP3-16781
Immunohistochemistry-Paraffin SOCS-2 Antibody (6D3F6)
Western Blot SOCS-2 Antibody (6D3F6)
Western Blot SOCS-2 Antibody (6D3F6)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
SOCS-5 Antibody
NB100-56639
Western Blot SOCS-5 Antibody
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB
PPAR gamma/NR1C3
Antibody - BSA Free
NBP2-22106
Western Blot PPAR gamma/NR1C3 Antibody - BSA Free
Immunohistochemistry-Paraffin PPAR gamma/NR1C3 Antibody - BSA Free
Western Blot PPAR gamma/NR1C3 Antibody - BSA Free
(2 Reviews)
(12 Publications)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Immunocytochemistry Insulin Antibody (182410) [Unconjugated]
Immunohistochemistry Insulin Antibody (182410) [Unconjugated]
(25 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
IL-6 [HRP]
M6000B
N/A IL-6 [HRP]
N/A IL-6 [HRP]
N/A IL-6 [HRP]
(672 Publications)
Species: Mu
Applications: ELISA
Jak2 Antibody
(53B7) - BSA Free
NBP2-59451
Flow Cytometry Jak2 Antibody (53B7) - BSA Free
Immunocytochemistry/ Immunofluorescence Jak2 Antibody (53B7) - BSA Free
Western Blot Jak2 Antibody (53B7) - BSA Free
(3 Reviews)
(3 Publications)
Species: Hu
Applications: ELISA, Flow, ICC/IF, MiAr, WB
IL-4 [Unconjugated]
6507-IL/CF
Bioactivity IL-4 [Unconjugated]
(3 Publications)
Species: Hu
Applications: BA
Leptin/OB [HRP]
DLP00
N/A Leptin/OB [HRP]
N/A Leptin/OB [HRP]
(156 Publications)
Species: Hu
Applications: ELISA
STAT3 Antibody
(232209) [Unconjugate
MAB1799
Knockout Validated STAT3 Antibody (232209) [Unconjugated]
Western Blot STAT3 Antibody (232209) [Unconjugated]
Knockout Validated STAT3 Antibody (232209) [Unconjugated]
(23 Publications)
Species: Hu, Mu, Rt
Applications: ICC, IP, ICFlow, KO, WB
SOCS-4 Antibody
(517331) [Unconjugate
MAB5628
Western Blot SOCS-4 Antibody (517331) [Unconjugated]
(4 Publications)
Species: Hu, Mu
Applications: WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(820 Publications)
Species: Hu
Applications: BA
Prolactin Antibody
[Unconjugated]
AF1445
Neutralization Prolactin Antibody [Unconjugated]
Western Blot Prolactin Antibody [Unconjugated]
Immunohistochemistry Prolactin Antibody [Unconjugated]
(7 Publications)
Species: Mu, Rt
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, Simple Western, WB
SOAT1 Antibody
NB400-141
SOAT1 Antibody
(7 Publications)
Species: Ha, Hu, Mu
Applications: ICC/IF, IP, WB
IRS1 Antibody
NB100-82001
Immunohistochemistry-Paraffin IRS1 Antibody
Western Blot IRS1 Antibody
Immunocytochemistry/ Immunofluorescence IRS1 Antibody
(4 Publications)
Species: Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AKT [p Ser473]
Antibody [Unconjugate ...
AF887
Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
(50 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Growth Hormone
Antibody [Unconjugate
AF1067
Western Blot Growth Hormone Antibody [Unconjugated]
ELISA Growth Hormone Antibody [Unconjugated]
Neutralization Growth Hormone Antibody [Unconjugated]
(15 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
ERK1 Antibody
(1E5) - BSA Free
NBP2-22203
Flow Cytometry ERK1 Antibody (1E5) - BSA Free
Immunocytochemistry/ Immunofluorescence ERK1 Antibody (1E5) - BSA Free
Immunohistochemistry-Paraffin ERK1 Antibody (1E5) - BSA Free
(1 Publication)
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB

Publications for SOCS-7/Nck/NAP4 Protein (NBP2-13363PEP) (0)

There are no publications for SOCS-7/Nck/NAP4 Protein (NBP2-13363PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SOCS-7/Nck/NAP4 Protein (NBP2-13363PEP) (0)

There are no reviews for SOCS-7/Nck/NAP4 Protein (NBP2-13363PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for SOCS-7/Nck/NAP4 Protein (NBP2-13363PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SOCS-7/Nck/NAP4 Products

Research Areas for SOCS-7/Nck/NAP4 Protein (NBP2-13363PEP)

Find related products by research area.

Blogs on SOCS-7/Nck/NAP4

There are no specific blogs for SOCS-7/Nck/NAP4, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SOCS-7/Nck/NAP4 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol SOCS7