![Immunocytochemistry/Immunofluorescence: SLC37A4 Antibody [NBP2-31972] - Staining of human cell line U-251 MG shows localization to mitochondria. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/SLC37A4-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-31972-img0006.jpg "Immunocytochemistry/Immunofluorescence: SLC37A4 Antibody [NBP2-31972] - Staining of human cell line U-251 MG shows localization to mitochondria. Antibody staining is shown in green.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: LDKDDLGFITSSQSAAYAISKFVSGVLSDQMS |
| Predicted Species | Mouse (97%), Rat (97%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SLC37A4 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP2-31972 | Applications | Species |
|---|---|---|
| Gautier-Stein A, Chilloux J, Soty M et al. A caveolin-1 dependent glucose-6-phosphatase trafficking contributes to hepatic glucose production Molecular metabolism 2023-04-01 [PMID: 36870604] (Western Blot, Mouse) | Western Blot | Mouse |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: SLC37A4 Antibody [NBP2-31972] - Staining of human lymph node shows low expression as expected.](http://images.novusbio.com/fullsize/SLC37A4-Antibody-Immunohistochemistry-Paraffin-NBP2-31972-img0007.jpg "Immunohistochemistry-Paraffin: SLC37A4 Antibody [NBP2-31972] - Staining of human lymph node shows low expression as expected.")
![Immunohistochemistry-Paraffin: SLC37A4 Antibody [NBP2-31972] - Staining of human kidney shows strong cytoplasmic positivity in renal tubules.](http://images.novusbio.com/fullsize/SLC37A4-Antibody-Immunohistochemistry-NBP2-31972-img0001.jpg "Immunohistochemistry-Paraffin: SLC37A4 Antibody [NBP2-31972] - Staining of human kidney shows strong cytoplasmic positivity in renal tubules.")
![Immunohistochemistry-Paraffin: SLC37A4 Antibody [NBP2-31972] - Staining in human kidney and lymph node tissues using anti-SLC37A4 antibody. Corresponding SLC37A4 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/SLC37A4-Antibody-Immunohistochemistry-Paraffin-NBP2-31972-img0008.jpg "Immunohistochemistry-Paraffin: SLC37A4 Antibody [NBP2-31972] - Staining in human kidney and lymph node tissues using anti-SLC37A4 antibody. Corresponding SLC37A4 RNA-seq data are presented for the same tissues.")
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Neutralization G-CSF Antibody (67604) [Unconjugated]](https://images.novusbio.com/images2/G-CSF_MAB414_Block_Neutralize_9188.jpg)
![Western Blot Serpin A1/alpha 1-Antitrypsin Antibody (202808) [Unconjugated]](https://images.novusbio.com/images2/Serpin_A1_MAB1268_Western_Blot_17309.jpg)
![Simple Western Serpin A1/alpha 1-Antitrypsin Antibody (202808) [Unconjugated]](https://images.novusbio.com/images2/Serpin_A1_MAB1268_Immunocytochemistry__Immunofluorescence_17494.jpg)
![Immunocytochemistry Serpin A1/alpha 1-Antitrypsin Antibody (202808) [Unconjugated]](https://images.novusbio.com/images2/Serpin_A1_MAB1268_Immunocytochemistry_11973.jpg)
![Flow Cytometry MMP-14/MT1-MMP Antibody (128527) [Unconjugated]](https://images.novusbio.com/images2/MMP-14_MAB9181_Flow_Cytometry_11258.jpg)
![Immunohistochemistry MMP-14/MT1-MMP Antibody (128527) [Unconjugated]](https://images.novusbio.com/images2/mab9181_human-mmp-14-mt1-mmp-mab-clone-128527-immunohistochemistry-239202215152.jpg)
![Immunocytochemistry Glucagon Antibody (181402) [Unconjugated]](https://images.novusbio.com/images2/Glucagon_MAB1249_Immunocytochemistry_6560.jpg)
![Intracellular Staining by Flow Cytometry Glucagon Antibody (181402) [Unconjugated]](https://images.novusbio.com/images2/Glucagon_MAB1249_Flow_Cytometry_20264.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")