SLC25A10 Antibody Summary
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of Human SLC25A10. Peptide sequence: PFHEKVLLGSVSGLAGGFVGTPADLVNVRMQNDVKLPQGQRRNYAHALDG The peptide sequence for this immunogen was taken from within the described region. |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
SLC25A10 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS, 2% Sucrose |
Preservative |
0.09% Sodium Azide |
Concentration |
0.5 mg/ml |
Purity |
Affinity purified |
Alternate Names for SLC25A10 Antibody
Background
The mitochondrial dicarboxylate carrier protein (mDIC) belongs to superfamily of mitochondrial transporters. It has been demonstrated that the expression of mDIC leads to hyperpolarization of the mitochondria, as well as succinate uptake by the mitochondria. It is highly expressed in adipose tissue, where its expression is downregulated by insulin and upregulated by free fatty acids. mDIC is also thought to play a role in glyceroneogenesis.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IP, Neut, WB
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Species: Hu, Rt
Applications: ELISA, WB
Species: Hu
Applications: ELISA
Species: Mu
Applications: IHC, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Rt
Applications: WB
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, IP, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA
Species: Mu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: IHC, IP, WB
Species: Hu
Applications: WB
Publications for SLC25A10 Antibody (NBP2-83541) (0)
There are no publications for SLC25A10 Antibody (NBP2-83541).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for SLC25A10 Antibody (NBP2-83541) (0)
There are no reviews for SLC25A10 Antibody (NBP2-83541).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for SLC25A10 Antibody (NBP2-83541) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional SLC25A10 Products
Blogs on SLC25A10