![Immunohistochemistry-Paraffin: SFRS7 Antibody [NBP1-92382] - Staining in human testis and skeletal muscle tissues using anti-SRSF7 antibody. Corresponding SRSF7 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/SFRS7-Antibody-Immunohistochemistry-Paraffin-NBP1-92382-img0015.jpg "Immunohistochemistry-Paraffin: SFRS7 Antibody [NBP1-92382] - Staining in human testis and skeletal muscle tissues using anti-SRSF7 antibody. Corresponding SRSF7 RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: SRVRVELSTGMPRRSRFDRPPARRPFDPNDRCYECGE |
| Predicted Species | Mouse (100%), Rat (100%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SRSF7 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publications using NBP1-92382 | Applications | Species |
|---|---|---|
| Tran JR, Paulson DI, Moresco JJ et al. An APEX2 proximity ligation method for mapping interactions with the nuclear lamina Journal of Cell Biology 2021-01-04 [PMID: 33306092] | ||
| Tran JR, Paulson DI, Moresco JJ et al. The versatility of Ascorbate Peroxidase-aided mapping uncovers insights of the nuclear lamina interactions and function bioRxiv 2020-01-01 (ICC/IF, Human) | ICC/IF | Human |
Secondary Antibodies |
Isotype Controls |
Research Areas for SFRS7 Antibody (NBP1-92382)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SRSF7 |
![Immunocytochemistry/Immunofluorescence: SFRS7 Antibody [NBP1-92382] - Staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/SFRS7-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-92382-img0007.jpg "Immunocytochemistry/Immunofluorescence: SFRS7 Antibody [NBP1-92382] - Staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: SFRS7 Antibody [NBP1-92382] - Staining of human skeletal muscle shows low expression as expected.](http://images.novusbio.com/fullsize/SFRS7-Antibody-Immunohistochemistry-Paraffin-NBP1-92382-img0013.jpg "Immunohistochemistry-Paraffin: SFRS7 Antibody [NBP1-92382] - Staining of human skeletal muscle shows low expression as expected.")
![Immunohistochemistry-Paraffin: SFRS7 Antibody [NBP1-92382] - Staining of human testis shows high expression.](http://images.novusbio.com/fullsize/SFRS7-Antibody-Immunohistochemistry-Paraffin-NBP1-92382-img0014.jpg "Immunohistochemistry-Paraffin: SFRS7 Antibody [NBP1-92382] - Staining of human testis shows high expression.")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")