![Western Blot: TOP2B Antibody [NBP1-89527] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented. Loading control: Anti-GAPDH.](http://images.novusbio.com/fullsize/TOP2B-Antibody-Western-Blot-NBP1-89527-img0014.jpg "Western Blot: TOP2B Antibody [NBP1-89527] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented. Loading control: Anti-GAPDH.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, Simple Western, ICC/IF, IHC, KD |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LWKEDLAAFVEELDKVESQEREDVLAGMSGKAIKGKVGKPKVKKLQLEETMPSPYGRRIIPEITAMKADASKKLLKKKKGDLDTAAVKVEFDEEFSGAPVEGAGEEALTPSVPINKGPKPKREKKEPGTRVRKTPTSSGKPSA |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | TOP2B |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Images | Ratings | Applications | Species | Date | Details | ||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Verified Customer |
WB | Human | 08/04/2016 |
Summary
|
||||||||
Enlarge |
reviewed by:
Verified Customer |
IF | Human | 06/29/2016 |
Summary
|
Secondary Antibodies |
Isotype Controls |
Research Areas for TOP2B Antibody (NBP1-89527)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
5 | |
4 | |
3 | |
2 | |
1 |
| Verified Customer 08/04/2016 |
||
| Application: | WB | |
| Species: | Human |
| Verified Customer 06/29/2016 |
||
| Application: | IF | |
| Species: | Human |
| Gene Symbol | TOP2B |
![Immunocytochemistry/Immunofluorescence: TOP2B Antibody [NBP1-89527] - Staining of human cell line U-251 MG shows localization to nucleoplasm. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/TOP2B-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-89527-img0011.jpg "Immunocytochemistry/Immunofluorescence: TOP2B Antibody [NBP1-89527] - Staining of human cell line U-251 MG shows localization to nucleoplasm. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: TOP2B Antibody [NBP1-89527] - Staining of human pancreas shows weak to moderate nuclear positivity in islets of Langerhans and exocrine glandular cells.](http://images.novusbio.com/fullsize/TOP2B-Antibody-Immunohistochemistry-Paraffin-NBP1-89527-img0020.jpg "Immunohistochemistry-Paraffin: TOP2B Antibody [NBP1-89527] - Staining of human pancreas shows weak to moderate nuclear positivity in islets of Langerhans and exocrine glandular cells.")
![Western Blot: TOP2B Antibody [NBP1-89527] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.](http://images.novusbio.com/fullsize/TOP2B-Antibody-Western-Blot-NBP1-89527-img0012.jpg "Western Blot: TOP2B Antibody [NBP1-89527] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.")
![Immunohistochemistry-Paraffin: TOP2B Antibody [NBP1-89527] - Staining of human cerebral cortex shows strong nuclear positivity in neurons.](http://images.novusbio.com/fullsize/TOP2B-Antibody-Immunohistochemistry-Paraffin-NBP1-89527-img0017.jpg "Immunohistochemistry-Paraffin: TOP2B Antibody [NBP1-89527] - Staining of human cerebral cortex shows strong nuclear positivity in neurons.")
![Immunohistochemistry-Paraffin: TOP2B Antibody [NBP1-89527] - Staining of human gastrointestinal shows strong nuclear positivity in glandular cells.](http://images.novusbio.com/fullsize/TOP2B-Antibody-Immunohistochemistry-Paraffin-NBP1-89527-img0018.jpg "Immunohistochemistry-Paraffin: TOP2B Antibody [NBP1-89527] - Staining of human gastrointestinal shows strong nuclear positivity in glandular cells.")
![Immunohistochemistry-Paraffin: TOP2B Antibody [NBP1-89527] - Staining of human kidney shows moderate nuclear positivity in cells in glomeruli and tubules.](http://images.novusbio.com/fullsize/TOP2B-Antibody-Immunohistochemistry-Paraffin-NBP1-89527-img0019.jpg "Immunohistochemistry-Paraffin: TOP2B Antibody [NBP1-89527] - Staining of human kidney shows moderate nuclear positivity in cells in glomeruli and tubules.")
![Simple Western: TOP2B Antibody [NBP1-89527] - Simple Western lane view shows a specific band for TOP2B in 0.2 mg/ml of RT-4 lysate. This experiment was performed under reducing conditions using the 66-440 kDa separation system.](http://images.novusbio.com/fullsize/TOP2B-Antibody-Simple-Western-NBP1-89527-img0007.jpg "Simple Western: TOP2B Antibody [NBP1-89527] - Simple Western lane view shows a specific band for TOP2B in 0.2 mg/ml of RT-4 lysate. This experiment was performed under reducing conditions using the 66-440 kDa separation system.")
![Simple Western: TOP2B Antibody [NBP1-89527] - Electropherogram image(s) of corresponding Simple Western lane view. TOP2B antibody was used at 1:100 dilution on RT-4 lysate(s).](http://images.novusbio.com/fullsize/TOP2B-Antibody-Simple-Western-NBP1-89527-img0008.jpg "Simple Western: TOP2B Antibody [NBP1-89527] - Electropherogram image(s) of corresponding Simple Western lane view. TOP2B antibody was used at 1:100 dilution on RT-4 lysate(s).")
![Western Blot Androgen R/NR3C4 [p Ser213, p Ser210] Antibody (156C135.2) - BSA Free](https://images.novusbio.com/images/Androgen-R-NR3C4-p-Ser213-p-Ser210-Antibody-156C135-2-Western-Blot-NB100-56603-img0004.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![SDS-PAGE ErbB2/Her2 [Unconjugated]](https://images.novusbio.com/images2/ErbB2_1129-ER_70.jpg)
![Bioactivity ErbB2/Her2 [Unconjugated]](https://images.novusbio.com/images2/1129-er_recombinant-human-erbb2-her2-fc-chimera-protein-cf-bioactivity-7122020142841.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
