![Western Blot: SFRS3 Antibody (2D2) [H00006428-M08] - Analysis of SFRS3 expression in Raw 264.7 (Cat # L024V1).](http://images.novusbio.com/fullsize/SFRS3-Antibody-2D2-Western-Blot-H00006428-M08-img0011.jpg "Western Blot: SFRS3 Antibody (2D2) [H00006428-M08] - Analysis of SFRS3 expression in Raw 264.7 (Cat # L024V1).")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ELISA, ICC/IF, IP |
| Clone | 2D2 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Description | Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen | SFRS3 (NP_003008, 1 a.a. ~ 85 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MHRDSCPLDCKVYVGNLGNNGNKTELERAFGYYGPLRSVWVARNPPGFAFVEFEDPRDAADAVRELDGRTLCGCRVRVELSNGEK |
| Specificity | SFRS3 (2D2) |
| Isotype | IgG1 Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | SRSF3 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF and ELISA. |
|
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: SFRS3 Antibody (2D2) [H00006428-M08] - Analysis of monoclonal antibody to SFRS3 on HeLa cell. Antibody concentration 10 ug/ml](http://images.novusbio.com/fullsize/SFRS3-Antibody-2D2-Immunocytochemistry-Immunofluorescence-H00006428-M08-img0008.jpg "Immunocytochemistry/Immunofluorescence: SFRS3 Antibody (2D2) [H00006428-M08] - Analysis of monoclonal antibody to SFRS3 on HeLa cell. Antibody concentration 10 ug/ml")
![Western Blot: SFRS3 Antibody (2D2) [H00006428-M08] - Analysis of SFRS3 expression in HeLa (Cat # L013V1).](http://images.novusbio.com/fullsize/SFRS3-Antibody-2D2-Western-Blot-H00006428-M08-img0009.jpg "Western Blot: SFRS3 Antibody (2D2) [H00006428-M08] - Analysis of SFRS3 expression in HeLa (Cat # L013V1).")
![Western Blot: SFRS3 Antibody (2D2) [H00006428-M08] - Analysis of SFRS3 expression in PC-12 (Cat # L012V1).](http://images.novusbio.com/fullsize/SFRS3-Antibody-2D2-Western-Blot-H00006428-M08-img0010.jpg "Western Blot: SFRS3 Antibody (2D2) [H00006428-M08] - Analysis of SFRS3 expression in PC-12 (Cat # L012V1).")
![Western Blot: SFRS3 Antibody (2D2) [H00006428-M08] - Analysis of SFRS3 expression in NIH/3T3 (Cat # L018V1).](http://images.novusbio.com/fullsize/SFRS3-Antibody-2D2-Western-Blot-H00006428-M08-img0012.jpg "Western Blot: SFRS3 Antibody (2D2) [H00006428-M08] - Analysis of SFRS3 expression in NIH/3T3 (Cat # L018V1).")
![ELISA: SFRS3 Antibody (2D2) [H00006428-M08] - Detection limit for recombinant GST tagged SFRS3 is approximately 0.1ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/SFRS3-Antibody-2D2-ELISA-H00006428-M08-img0006.jpg "ELISA: SFRS3 Antibody (2D2) [H00006428-M08] - Detection limit for recombinant GST tagged SFRS3 is approximately 0.1ng/ml as a capture antibody.")
![Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.](https://images.novusbio.com/images/Mouse-IgG1-Kappa-Light-Chain-Isotype-Control-P3-6-2-8-1-Flow-Cytometry-NBP1-43319-img0002.jpg "Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.")