![Western Blot: sFRP-4 Antibody [NBP1-81866] - Analysis in control (vector only transfected HEK293T lysate) and sFRP4 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize/sFRP-4-Antibody-Western-Blot-NBP1-81866-img0009.jpg "Western Blot: sFRP-4 Antibody [NBP1-81866] - Analysis in control (vector only transfected HEK293T lysate) and sFRP4 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: RHMPWNITRMPNHLHHSTQENAILAIEQYEELVDVNCSAVLRFFLCAMYAPICTLEFLHDPIKPCKSVCQRARDDCEPLMKMYNHSWPESLACDELPVYDRGVCISPEAIVTDLPEDVKWIDITPDMMVQERPLDVDCKR |
| Predicted Species | Mouse (97%), Rat (96%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SFRP4 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | IHC-P reported in scientific literature (PMID: 25232495). For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot beta-Catenin Antibody [Unconjugated]](https://images.novusbio.com/images2/beta-Catenin_AF1329_Western_Blot_5100.jpg)
![Chromatin Immunoprecipitation (ChIP) beta-Catenin Antibody [Unconjugated]](https://images.novusbio.com/images2/beta-Catenin_AF1329_Chromatin_Immunoprecipitation_11251.jpg)
![Simple Western beta-Catenin Antibody [Unconjugated]](https://images.novusbio.com/images2/betaCatenin_AF1329_Simple_Western_17134.jpg)
![Immunohistochemistry PTH Antibody (918462) [Unconjugated]](https://images.novusbio.com/images2/PTH_MAB7665_Immunohistochemistry_16650.jpg)
![Western Blot PTH Antibody (918462) [Unconjugated]](https://images.novusbio.com/images2/PTH_MAB7665_Western_Blot_16656.jpg)
| Publication using NBP1-81866 | Applications | Species |
|---|---|---|
| Jiang H, Li Q, He C et al. Activation of the Wnt pathway through Wnt2 promotes metastasis in pancreatic cancer. Am J Cancer Res. 2014-09-18 [PMID: 25232495] (IHC-P, Human) | IHC-P | Human |
Secondary Antibodies |
Isotype Controls |
Research Areas for sFRP-4 Antibody (NBP1-81866)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SFRP4 |
![Immunohistochemistry-Paraffin: sFRP-4 Antibody [NBP1-81866] - Staining of human placenta shows no positivity in trophoblastic cells as expected.](http://images.novusbio.com/fullsize/sFRP-4-Antibody-Immunohistochemistry-Paraffin-NBP1-81866-img0023.jpg "Immunohistochemistry-Paraffin: sFRP-4 Antibody [NBP1-81866] - Staining of human placenta shows no positivity in trophoblastic cells as expected.")
![Immunohistochemistry-Paraffin: sFRP-4 Antibody [NBP1-81866] - Staining of human endometrium shows moderate secreted positivity in cells in endometrial stroma.](http://images.novusbio.com/fullsize/sFRP-4-Antibody-Immunohistochemistry-Paraffin-NBP1-81866-img0020.jpg "Immunohistochemistry-Paraffin: sFRP-4 Antibody [NBP1-81866] - Staining of human endometrium shows moderate secreted positivity in cells in endometrial stroma.")
![Immunohistochemistry-Paraffin: sFRP-4 Antibody [NBP1-81866] - Staining of human kidney shows no positivity in cells in tubules as expected.](http://images.novusbio.com/fullsize/sFRP-4-Antibody-Immunohistochemistry-Paraffin-NBP1-81866-img0021.jpg "Immunohistochemistry-Paraffin: sFRP-4 Antibody [NBP1-81866] - Staining of human kidney shows no positivity in cells in tubules as expected.")
![Immunohistochemistry-Paraffin: sFRP-4 Antibody [NBP1-81866] - Staining of human liver shows no positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize/sFRP-4-Antibody-Immunohistochemistry-Paraffin-NBP1-81866-img0022.jpg "Immunohistochemistry-Paraffin: sFRP-4 Antibody [NBP1-81866] - Staining of human liver shows no positivity in hepatocytes as expected.")
![Immunohistochemistry FGF-23 Antibody (283507) [Unconjugated]](https://images.novusbio.com/images2/FGF23_MAB26291_Immunohistochemistry_17626.jpg)
![Immunohistochemistry FGF-23 Antibody (283507) [Unconjugated]](https://images.novusbio.com/images/mab26291_mouse-fgf-23-mab-clone-283507-41202412512640.jpg)
![Western Blot FGF-23 Antibody (283507) [Unconjugated]](https://images.novusbio.com/images/mab26291_mouse-fgf-23-mab-clone-283507-41202412514876.jpg)
![Immunohistochemistry Dkk-3 Antibody [Unconjugated]](https://images.novusbio.com/images2/af1118_human-dkk-3-affinity-purified-polyclonal-ab-immunohistochemistry-26102022101347.jpg)
![Immunohistochemistry Dkk-3 Antibody [Unconjugated]](https://images.novusbio.com/images/af1118_human-dkk-3-affinity-purified-polyclonal-ab-8220249505964.jpg)
![Western Blot Dkk-3 Antibody [Unconjugated]](https://images.novusbio.com/images/af1118_human-dkk-3-affinity-purified-polyclonal-ab-8220249505942.jpg)
![Bioactivity KGF/FGF-7 [Unconjugated]](https://images.novusbio.com/images2/KGF_251KG_2860.jpg)
![Bioactivity KGF/FGF-7 [Unconjugated]](https://images.novusbio.com/images/251-kg_recombinant-human-kgf-fgf-7-protein-bioactivity-2520239811.jpg)
![Cell Culture Dkk-1 [Unconjugated]](https://images.novusbio.com/images/5439-dk_recombinant-human-dkk-1-protein-105202416017.jpg)
![Cell Culture Dkk-1 [Unconjugated]](https://images.novusbio.com/images/5439-dk_recombinant-human-dkk-1-protein-cell-culture-105202416211..jpg)
![Bioactivity Dkk-1 [Unconjugated]](https://images.novusbio.com/images/5439-dk_recombinant-human-dkk-1-protein-bioactivity-135202491415..jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")