![Immunohistochemistry-Paraffin: Secretogranin V Antibody [NBP1-90312] - Analysis in human adrenal gland and skeletal muscle tissues using NBP1-90312 antibody. Corresponding Secretogranin V RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Secretogranin-V-Antibody-Immunohistochemistry-Paraffin-NBP1-90312-img0010.jpg "Immunohistochemistry-Paraffin: Secretogranin V Antibody [NBP1-90312] - Analysis in human adrenal gland and skeletal muscle tissues using NBP1-90312 antibody. Corresponding Secretogranin V RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: EGLQHLGPFGNIPNIVAELTGDNIPKDFSEDQGYPDPPNPCPVGKTADDGCLENTPDTAEFSREFQLHQHLFDPEHDYPGLGKWNKKLLYEKMKGGERRKRRSVNPYLQGQRLDNVVAKKSV |
| Predicted Species | Mouse (96%), Rat (96%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SCG5 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunohistochemistry Neurophysin II/Arg-vasopressin Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af009_human-neurophysin-ii-affinity-purified-polyclonal-ab-immunohistochemistry-2812202013195.jpg)
| Publication using NBP1-90312 | Applications | Species |
|---|---|---|
| Lindskog C, Korsgren O, Ponten F et al. Novel pancreatic beta cell-specific proteins: antibody-based proteomics for identification of new biomarker candidates. J Proteomics 2012-05-17 [PMID: 22465717] |
Secondary Antibodies |
Isotype Controls |
Research Areas for Secretogranin V Antibody (NBP1-90312)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SCG5 |
![Immunohistochemistry-Paraffin: Secretogranin V Antibody [NBP1-90312] - Staining of human lymphoid tissues, pancreas, pituitary gland and skeletal muscle using Anti-Secretogranin V antibody NBP1-90312 (A) shows similar protein distribution across tissues to independent antibody NBP2-68983 (B).](http://images.novusbio.com/fullsize/Secretogranin-V-Antibody-Immunohistochemistry-Paraffin-NBP1-90312-img0009.jpg "Immunohistochemistry-Paraffin: Secretogranin V Antibody [NBP1-90312] - Staining of human lymphoid tissues, pancreas, pituitary gland and skeletal muscle using Anti-Secretogranin V antibody NBP1-90312 (A) shows similar protein distribution across tissues to independent antibody NBP2-68983 (B).")
![Immunohistochemistry-Paraffin: Secretogranin V Antibody [NBP1-90312] - Staining of human skeletal muscle shows no cytoplasmic positivity in myocytes as expected.](http://images.novusbio.com/fullsize/Secretogranin-V-Antibody-Immunohistochemistry-Paraffin-NBP1-90312-img0017.jpg "Immunohistochemistry-Paraffin: Secretogranin V Antibody [NBP1-90312] - Staining of human skeletal muscle shows no cytoplasmic positivity in myocytes as expected.")
![Immunohistochemistry-Paraffin: Secretogranin V Antibody [NBP1-90312] - Staining of human pituitary gland shows strong cytoplasmic positivity in endocrine glandular cells.](http://images.novusbio.com/fullsize/Secretogranin-V-Antibody-Immunohistochemistry-Paraffin-NBP1-90312-img0012.jpg "Immunohistochemistry-Paraffin: Secretogranin V Antibody [NBP1-90312] - Staining of human pituitary gland shows strong cytoplasmic positivity in endocrine glandular cells.")
![Immunohistochemistry-Paraffin: Secretogranin V Antibody [NBP1-90312] - Staining of human addrenal gland shows strong cytoplasmic positivity in endocrine glandular cells.](http://images.novusbio.com/fullsize/Secretogranin-V-Antibody-Immunohistochemistry-Paraffin-NBP1-90312-img0013.jpg "Immunohistochemistry-Paraffin: Secretogranin V Antibody [NBP1-90312] - Staining of human addrenal gland shows strong cytoplasmic positivity in endocrine glandular cells.")
![Immunohistochemistry-Paraffin: Secretogranin V Antibody [NBP1-90312] - Staining of human duodenum shows strong cytoplasmic positivity in enteroendocrine cells.](http://images.novusbio.com/fullsize/Secretogranin-V-Antibody-Immunohistochemistry-Paraffin-NBP1-90312-img0014.jpg "Immunohistochemistry-Paraffin: Secretogranin V Antibody [NBP1-90312] - Staining of human duodenum shows strong cytoplasmic positivity in enteroendocrine cells.")
![Immunohistochemistry-Paraffin: Secretogranin V Antibody [NBP1-90312] - Staining of human pancreas shows strong cytoplasmic positivity in islets of Langerhans.](http://images.novusbio.com/fullsize/Secretogranin-V-Antibody-Immunohistochemistry-Paraffin-NBP1-90312-img0015.jpg "Immunohistochemistry-Paraffin: Secretogranin V Antibody [NBP1-90312] - Staining of human pancreas shows strong cytoplasmic positivity in islets of Langerhans.")
![Immunohistochemistry-Paraffin: Secretogranin V Antibody [NBP1-90312] - Staining of human lymph node shows no positivity in germinal center cells and non-germinal center cells as expected.](http://images.novusbio.com/fullsize/Secretogranin-V-Antibody-Immunohistochemistry-Paraffin-NBP1-90312-img0016.jpg "Immunohistochemistry-Paraffin: Secretogranin V Antibody [NBP1-90312] - Staining of human lymph node shows no positivity in germinal center cells and non-germinal center cells as expected.")
![Intracellular Staining by Flow Cytometry Carboxypeptidase E/CPE Antibody [Unconjugated]](https://images.novusbio.com/images2/Carboxypeptidase_E_AF3587_Flow_Cytometry_3467.jpg)
![Immunocytochemistry Carboxypeptidase E/CPE Antibody [Unconjugated]](https://images.novusbio.com/images2/Carboxypeptidase_E_AF3587_Immunocytochemistry_12010.jpg)
![Immunohistochemistry Carboxypeptidase E/CPE Antibody [Unconjugated]](https://images.novusbio.com/images2/Carboxypeptidase_E_AF3587_Immunohistochemistry_12592.jpg)
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Immunocytochemistry Glucagon Antibody (181402) [Unconjugated]](https://images.novusbio.com/images2/Glucagon_MAB1249_Immunocytochemistry_6560.jpg)
![Intracellular Staining by Flow Cytometry Glucagon Antibody (181402) [Unconjugated]](https://images.novusbio.com/images2/Glucagon_MAB1249_Flow_Cytometry_20264.jpg)
![Bioactivity GM-CSF [Unconjugated]](https://images.novusbio.com/images/protein/7954-gmcf_recombinant-human-gm-csf-cho-expressed-protein-cf-bioactivity-272020121514.jpg)
![Western Blot Growth Hormone Antibody [Unconjugated]](https://images.novusbio.com/images2/Growth_Hormone_AF1067_Western_Blot_20961.jpg)
![ELISA Growth Hormone Antibody [Unconjugated]](https://images.novusbio.com/images2/Growth_Hormone_AF1067_ELISA_22201.jpg)
![Neutralization Growth Hormone Antibody [Unconjugated]](https://images.novusbio.com/images2/Growth_Hormone_AF1067_Block_Neutralize_8751.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")