SEC61A Antibody - Azide and BSA Free Summary
Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 310-420 of human SEC61A1 (NP_037468.1). ARFSGNLLVSLLGTWSDTSSGGPARAYPVGGLCYYLSPPESFGSVLEDPVHAVVYIVFMLGSCAFFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRETSMVHELNRYIPTA |
Specificity |
This antibody made against SEC61A1 but the immunogen shows high sequence identity with human SEC61A2. Reactivity with SEC61A2 has not been determined experimentally. |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
SEC61A1 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Western Blot 1:500-1:2000
|
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.3), 50% glycerol |
Preservative |
0.01% Thimerosal |
Purity |
Affinity purified |
Alternate Names for SEC61A Antibody - Azide and BSA Free
Background
SEC61A belongs to the SECY/SEC61 alpha family. It has similarity to a mouse protein which suggests a role in the insertion of secretory and membrane polypeptides into the endoplasmic reticulum.The SEC61 complex is responsible for translocation of proteins across the rough endoplasmic reticulum membrane. SEC61 is composed of three subunits: alpha, beta, and gamma; that associate to form a heterotrimer. Multiple heterotrimers associate forming the ER translocon. SEC61 alpha is a polytopic protein that has ten membrane-spanning loops. SEC61 has been found to be tightly associated with membrane bound ribosomes, either directly or through adaptor proteins, and is required for assembly of membrane and secretory proteins.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Ce, Ch, Dr, Hu, Mu, Rt, Sh, Ze
Applications: Flow, ICC/IF, IHC-FrFl, IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Ca, Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IP, WB
Species: Hu
Applications: WB
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ELISA, IHC, IHC-P, WB
Species: Ha, Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, KO, WB
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IP, RIA, WB
Species: Hu
Applications: IHC, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Bv, Hu, Mu, Ma-Op, Pm, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ELISA, S-ELISA, WB
Species: Ca, ChHa, Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu, Rt
Applications: WB
⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov
Publications for SEC61A Antibody (NBP2-93597) (0)
There are no publications for SEC61A Antibody (NBP2-93597).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for SEC61A Antibody (NBP2-93597) (0)
There are no reviews for SEC61A Antibody (NBP2-93597).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for SEC61A Antibody (NBP2-93597) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional SEC61A Products
Research Areas for SEC61A Antibody (NBP2-93597)
Find related products by research area.
|
Blogs on SEC61A