![Western Blot: SEC63 Antibody [NBP2-30405] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: SK-MEL-30](http://images.novusbio.com/fullsize/SEC63-Antibody-Western-Blot-NBP2-30405-img0002.jpg "Western Blot: SEC63 Antibody [NBP2-30405] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: SK-MEL-30")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: REYQEYNPYEVLNLDPGATVAEIKKQYRLLSLKYHPDKGGDEVMFMRIAKAYAALTDEESRKNWEEFGNPDGPQATSFGIALPA |
| Predicted Species | Mouse (100%), Rat (100%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SEC63 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunocytochemistry Polycystin-1/PKD1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Polycystin1_AF6270_Immunocytochemistry__Immunofluorescence_20130.jpg)
| Publication using NBP2-30405 | Applications | Species |
|---|---|---|
| Zhang J, Andersen JP, Sun H et al. Aster-C coordinates with COP I vesicles to regulate lysosomal trafficking and activation of mTORC1 EMBO Rep. 2020-07-09 [PMID: 32648345] |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: SEC63 Antibody [NBP2-30405] - Staining of human cell line Hep G2 shows localization to endoplasmic reticulum.](http://images.novusbio.com/fullsize/SEC63-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-30405-img0003.jpg "Immunocytochemistry/Immunofluorescence: SEC63 Antibody [NBP2-30405] - Staining of human cell line Hep G2 shows localization to endoplasmic reticulum.")
![Immunohistochemistry-Paraffin: SEC63 Antibody [NBP2-30405] - Staining of human pancreas shows moderate cytoplasmic positivity in exocrine glandular cells.](http://images.novusbio.com/fullsize/SEC63-Antibody-Immunohistochemistry-Paraffin-NBP2-30405-img0011.jpg "Immunohistochemistry-Paraffin: SEC63 Antibody [NBP2-30405] - Staining of human pancreas shows moderate cytoplasmic positivity in exocrine glandular cells.")
![Immunohistochemistry-Paraffin: SEC63 Antibody [NBP2-30405] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.](http://images.novusbio.com/fullsize/SEC63-Antibody-Immunohistochemistry-Paraffin-NBP2-30405-img0004.jpg "Immunohistochemistry-Paraffin: SEC63 Antibody [NBP2-30405] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.")
![Immunohistochemistry-Paraffin: SEC63 Antibody [NBP2-30405] - Staining of human skeletal muscle shows low expression as expected.](http://images.novusbio.com/fullsize/SEC63-Antibody-Immunohistochemistry-Paraffin-NBP2-30405-img0005.jpg "Immunohistochemistry-Paraffin: SEC63 Antibody [NBP2-30405] - Staining of human skeletal muscle shows low expression as expected.")
![Immunohistochemistry-Paraffin: SEC63 Antibody [NBP2-30405] - Staining of human testis shows high expression.](http://images.novusbio.com/fullsize/SEC63-Antibody-Immunohistochemistry-Paraffin-NBP2-30405-img0006.jpg "Immunohistochemistry-Paraffin: SEC63 Antibody [NBP2-30405] - Staining of human testis shows high expression.")
![Immunohistochemistry-Paraffin: SEC63 Antibody [NBP2-30405] - Analysis in human testis and skeletal muscle tissues using NBP2-30405 antibody. Corresponding SEC63 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/SEC63-Antibody-Immunohistochemistry-Paraffin-NBP2-30405-img0008.jpg "Immunohistochemistry-Paraffin: SEC63 Antibody [NBP2-30405] - Analysis in human testis and skeletal muscle tissues using NBP2-30405 antibody. Corresponding SEC63 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: SEC63 Antibody [NBP2-30405] - Staining of human testis shows strong granular cytoplasmic positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/SEC63-Antibody-Immunohistochemistry-Paraffin-NBP2-30405-img0009.jpg "Immunohistochemistry-Paraffin: SEC63 Antibody [NBP2-30405] - Staining of human testis shows strong granular cytoplasmic positivity in cells in seminiferous ducts.")
![Immunohistochemistry-Paraffin: SEC63 Antibody [NBP2-30405] - Staining of human salivary gland shows strong granular cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/SEC63-Antibody-Immunohistochemistry-Paraffin-NBP2-30405-img0010.jpg "Immunohistochemistry-Paraffin: SEC63 Antibody [NBP2-30405] - Staining of human salivary gland shows strong granular cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: SEC63 Antibody [NBP2-30405] - Staining of human skeletal muscle shows no positivity in myocytes as expected.](http://images.novusbio.com/fullsize/SEC63-Antibody-Immunohistochemistry-Paraffin-NBP2-30405-img0012.jpg "Immunohistochemistry-Paraffin: SEC63 Antibody [NBP2-30405] - Staining of human skeletal muscle shows no positivity in myocytes as expected.")
![Immunohistochemistry BMP-3b/GDF-10 Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af1543_human-bmp-3b-gdf-10-affinity-purified-polyclonal-ab-immunocytochemistry-133202414504.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")