Home » SCD-1 » SCD-1 Proteins » SCD-1 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

SCD-1 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for SCD-1 Recombinant Protein Antigen (NBP1-84749PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

SCD-1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SCD.

Source: E. coli

Amino Acid Sequence: ISSSYTTTTTITAPPSRVLQNGGDKLETMPLYLEDDIRPDIKDDIYDPTYKDKEGPSPKVEY

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SCD
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84749.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.
Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SCD-1 Recombinant Protein Antigen

  • FADS5
  • MSTP008
  • SCD1
  • SCD-1
  • SCDOS
  • Stearoyl-CoA desaturase

Background

SCD-1 encodes an enzyme involved in fatty acid biosynthesis, primarily the synthesis of oleic acid. The protein belongs to the fatty acid desaturase family and is an integral membrane protein located in the endoplasmic reticulum. Transcripts of approximately 3.9 and 5.2 kb, differing only by alternative polyadenlyation signals, have been detected. A gene encoding a similar enzyme is located on chromosome 4 and a pseudogene of this gene is located on chromosome 17. [provided by RefSeq, Sep 2015]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Fatty Acid
Synthase/FASN Antibod
NB400-114
Immunocytochemistry/ Immunofluorescence Fatty Acid Synthase/FASN Antibody
Western Blot Fatty Acid Synthase/FASN Antibody
Immunohistochemistry-Paraffin Fatty Acid Synthase/FASN Antibody
(2 Reviews)
(27 Publications)
Species: Ch, Fe, Ha, Hu, Mu, Pl, Po, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Immunocytochemistry Insulin Antibody (182410) [Unconjugated]
Immunohistochemistry Insulin Antibody (182410) [Unconjugated]
(24 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
SREBP1 Antibody
(2A4) - BSA Free
NB600-582
Western Blot SREBP1 Antibody (2A4) - BSA Free
Knockout Validated SREBP1 Antibody (2A4) - BSA Free
Simple Western SREBP1 Antibody (2A4) - BSA Free
(65 Publications)
Species: Ca, Ch, SyHa, Ha, Hu, Pm, Mu, Rt
Applications: IHC-Fr, KO, Simple Western, WB
SCD5 Antibody
NBP1-89274
Immunohistochemistry-Paraffin SCD5 Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P
PPAR gamma/NR1C3
Antibody - BSA Free
NBP2-22106
Western Blot PPAR gamma/NR1C3 Antibody - BSA Free
Immunohistochemistry-Paraffin PPAR gamma/NR1C3 Antibody - BSA Free
Western Blot PPAR gamma/NR1C3 Antibody - BSA Free
(2 Reviews)
(11 Publications)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Leptin/OB [HRP]
DLP00
N/A Leptin/OB [HRP]
N/A Leptin/OB [HRP]
(151 Publications)
Species: Hu
Applications: ELISA
FADS1 Antibody
(7A10)
NBP3-26590
Immunohistochemistry FADS1 Antibody (7A10)
Western Blot FADS1 Antibody (7A10)
Immunocytochemistry/ Immunofluorescence FADS1 Antibody (7A10)
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, WB
Acetyl-CoA
Carboxylase alpha/ACA ...
MAB6898
Western Blot Acetyl-CoA Carboxylase alpha/ACACA Antibody (738421)
(3 Publications)
Species: Hu, Mu
Applications: WB
Fatty acid
desaturase 2 Antibody
NBP2-82734
Immunohistochemistry-Paraffin Fatty acid desaturase 2 Antibody
Immunohistochemistry-Paraffin Fatty acid desaturase 2 Antibody
Species: Hu
Applications: IHC, IHC-P, WB
Fas/TNFRSF6/CD95
Antibody - BSA Free
NB120-13550
Immunocytochemistry/ Immunofluorescence Fas/TNFRSF6/CD95 Antibody - BSA Free
Western Blot Fas/TNFRSF6/CD95 Antibody - BSA Free
Immunohistochemistry-Paraffin Fas/TNFRSF6/CD95 Antibody - BSA Free
(1 Review)
(4 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
FACA/FANCA Antibody
NB100-2564
Western Blot FACA/FANCA Antibody
(1 Publication)
Species: Hu
Applications: WB
Frataxin Antibody
(OTI1C12)
NBP2-01743
Flow Cytometry Frataxin Antibody (OTI1C12)
Western Blot Frataxin Antibody (OTI1C12)
Immunohistochemistry-Paraffin Frataxin Antibody (OTI1C12)
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
PSGL-1/CD162
Antibody (HECA-452)
NB100-78039
Flow Cytometry PSGL-1/CD162 Antibody (HECA-452)
Western Blot PSGL-1/CD162 Antibody (HECA-452)
Immunohistochemistry-Paraffin PSGL-1/CD162 Antibody (HECA-452)
(1 Review)
(12 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, ELISA, Flow-CS, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
BBS9 Antibody
NBP1-88927
Immunohistochemistry-Paraffin BBS9 Antibody
(3 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
PPAR alpha/NR1C1
Antibody (3B6/PPAR) - ...
NB300-537
Flow Cytometry PPAR alpha/NR1C1 Antibody (3B6/PPAR) - BSA Free
Western Blot PPAR alpha/NR1C1 Antibody (3B6/PPAR) - BSA Free
Flow Cytometry PPAR alpha/NR1C1 Antibody (3B6/PPAR) - BSA Free
(1 Review)
(16 Publications)
Species: Bv, Hu, Mu, Rb, Rt
Applications: ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, KD, WB
Lipoprotein
Lipase/LPL Antibody [ ...
AF7197
Immunohistochemistry Lipoprotein Lipase/LPL Antibody [Unconjugated]
Western Blot Lipoprotein Lipase/LPL Antibody [Unconjugated]
Immunocytochemistry Lipoprotein Lipase/LPL Antibody [Unconjugated]
(11 Publications)
Species: Hu, Mu
Applications: ICC, IHC, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(807 Publications)
Species: Hu
Applications: BA
SCD-1 Recombinant
Protein Antigen
NBP1-84749PEP
SCD-1 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for SCD-1 Recombinant Protein Antigen (NBP1-84749PEP) (0)

There are no publications for SCD-1 Recombinant Protein Antigen (NBP1-84749PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SCD-1 Recombinant Protein Antigen (NBP1-84749PEP) (0)

There are no reviews for SCD-1 Recombinant Protein Antigen (NBP1-84749PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for SCD-1 Recombinant Protein Antigen (NBP1-84749PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SCD-1 Products

Research Areas for SCD-1 Recombinant Protein Antigen (NBP1-84749PEP)

Find related products by research area.

Blogs on SCD-1

There are no specific blogs for SCD-1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SCD-1 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol SCD