![Immunocytochemistry/Immunofluorescence: SAPS3 Antibody [NBP2-34048] - Immunofluorescent staining of human cell line CACO-2 shows localization to nucleoplasm, plasma membrane & cytosol.](http://images.novusbio.com/fullsize/SAPS3-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-34048-img0005.jpg "Immunocytochemistry/Immunofluorescence: SAPS3 Antibody [NBP2-34048] - Immunofluorescent staining of human cell line CACO-2 shows localization to nucleoplasm, plasma membrane & cytosol.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: DGAKQDLFEPSSANTEDKMEVDLSEPPNWSANFDVPMETTHGAPLDSVGSDVWSTEEPMPTKETGWASFSEFTSSLSTKDSLRSNSPVEMETSTEP |
| Predicted Species | Mouse (95%), Rat (96%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | PPP6R3 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for SAPS3 Antibody (NBP2-34048)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: SAPS3 Antibody [NBP2-34048] - Staining in human parathyroid gland and pancreas tissues using anti-PPP6R3 antibody. Corresponding PPP6R3 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/SAPS3-Antibody-Immunohistochemistry-Paraffin-NBP2-34048-img0008.jpg "Immunohistochemistry-Paraffin: SAPS3 Antibody [NBP2-34048] - Staining in human parathyroid gland and pancreas tissues using anti-PPP6R3 antibody. Corresponding PPP6R3 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: SAPS3 Antibody [NBP2-34048] - Staining of human prostate shows strong cytoplasmic and nuclear positivity in glandular cells.](http://images.novusbio.com/fullsize/SAPS3-Antibody-Immunohistochemistry-Paraffin-NBP2-34048-img0002.jpg "Immunohistochemistry-Paraffin: SAPS3 Antibody [NBP2-34048] - Staining of human prostate shows strong cytoplasmic and nuclear positivity in glandular cells.")
![Immunohistochemistry-Paraffin: SAPS3 Antibody [NBP2-34048] - Staining of human pancreas shows low expression as expected.](http://images.novusbio.com/fullsize/SAPS3-Antibody-Immunohistochemistry-Paraffin-NBP2-34048-img0006.jpg "Immunohistochemistry-Paraffin: SAPS3 Antibody [NBP2-34048] - Staining of human pancreas shows low expression as expected.")
![Immunohistochemistry-Paraffin: SAPS3 Antibody [NBP2-34048] - Staining of human parathyroid gland shows high expression.](http://images.novusbio.com/fullsize/SAPS3-Antibody-Immunohistochemistry-Paraffin-NBP2-34048-img0007.jpg "Immunohistochemistry-Paraffin: SAPS3 Antibody [NBP2-34048] - Staining of human parathyroid gland shows high expression.")
![Western Blot Pentraxin 2/SAP Antibody [Unconjugated]](https://images.novusbio.com/images2/Pentraxin_2_AF2558_Western_Blot_15557.jpg)
![Simple Western Pentraxin 2/SAP Antibody [Unconjugated]](https://images.novusbio.com/images2/Pentraxin_2_AF2558_Simple_Western_17977.jpg)
![Western Blot Histone H2AX [p Ser139] Antibody [Unconjugated]](https://images.novusbio.com/images2/Histone_H2AX_AF2288_Western_Blot_5182.jpg)
![Simple Western Histone H2AX [p Ser139] Antibody [Unconjugated]](https://images.novusbio.com/images2/16395.jpg)
![Immunocytochemistry Histone H2AX [p Ser139] Antibody [Unconjugated]](https://images.novusbio.com/images2/Histone_H2AX_AF2288_Immunocytochemistry__Immunofluorescence_16920.jpg)
![Flow Cytometry Annexin V Apoptosis Kit [FITC]](https://images.novusbio.com/images/Annexin-V-Apoptosis-Kit-[FITC]-Flow-Cytometry-NBP2-29373-img0001.jpg)
![Flow Cytometry Annexin V Apoptosis Kit [FITC]](https://images.novusbio.com/images/Annexin-V-Apoptosis-Kit-[FITC]-Flow-Cytometry-NBP2-29373-img0003.jpg)
![Flow Cytometry Annexin V Apoptosis Kit [FITC]](https://images.novusbio.com/images/Annexin-V-Apoptosis-Kit-[FITC]-Flow-Cytometry-NBP2-29373-img0004.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")