![Western Blot: SCAP2 Antibody [NBP2-47289] - Analysis in control (vector only transfected HEK293T lysate) and SKAP2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize/SCAP2-Antibody-Western-Blot-NBP2-47289-img0010.jpg "Western Blot: SCAP2 Antibody [NBP2-47289] - Analysis in control (vector only transfected HEK293T lysate) and SKAP2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: LPEEIRNLLADVETFVADILKGENLSKKAKEKRESLIKKIKDVKSIYLQEFQDKGDAEDGEEYDDPFAGPPDTISLASERYDKDDEAPSDGAQFPPIAAQDLPFVLKAGYLEKRRKDHSFLGFEWQKRWCALSKTVFYY |
| Predicted Species | Mouse (94%), Rat (91%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SKAP2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Simple Western Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Simple_Western_21888.jpg)
![Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunocytochemistry__Immunofluorescence_17777.jpg)
![Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunohistochemistry_23317.jpg)
![Western Blot FYB/ADAP/SLAP130 Antibody [Unconjugated]](https://images.novusbio.com/images2/SLAP-130_AF3857_Western_Blot_5357.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for SCAP2 Antibody (NBP2-47289)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SKAP2 |
![Immunocytochemistry/Immunofluorescence: SCAP2 Antibody [NBP2-47289] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol.](http://images.novusbio.com/fullsize/SCAP2-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-47289-img0004.jpg "Immunocytochemistry/Immunofluorescence: SCAP2 Antibody [NBP2-47289] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol.")
![Immunohistochemistry-Paraffin: SCAP2 Antibody [NBP2-47289] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.](http://images.novusbio.com/fullsize/SCAP2-Antibody-Immunohistochemistry-Paraffin-NBP2-47289-img0018.jpg "Immunohistochemistry-Paraffin: SCAP2 Antibody [NBP2-47289] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.")
![Immunohistochemistry-Paraffin: SCAP2 Antibody [NBP2-47289] - Staining of human lymph node shows distinct cytoplasmic positivity in a subset of cells.](http://images.novusbio.com/fullsize/SCAP2-Antibody-Immunohistochemistry-Paraffin-NBP2-47289-img0005.jpg "Immunohistochemistry-Paraffin: SCAP2 Antibody [NBP2-47289] - Staining of human lymph node shows distinct cytoplasmic positivity in a subset of cells.")
![Immunohistochemistry-Paraffin: SCAP2 Antibody [NBP2-47289] - Analysis in human lung and pancreas tissues. Corresponding SCAP2 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/SCAP2-Antibody-Immunohistochemistry-Paraffin-NBP2-47289-img0014.jpg "Immunohistochemistry-Paraffin: SCAP2 Antibody [NBP2-47289] - Analysis in human lung and pancreas tissues. Corresponding SCAP2 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: SCAP2 Antibody [NBP2-47289] - Staining of human duodenum shows moderate cytoplasmic positivity in lymphoid cells.](http://images.novusbio.com/fullsize/SCAP2-Antibody-Immunohistochemistry-Paraffin-NBP2-47289-img0015.jpg "Immunohistochemistry-Paraffin: SCAP2 Antibody [NBP2-47289] - Staining of human duodenum shows moderate cytoplasmic positivity in lymphoid cells.")
![Immunohistochemistry-Paraffin: SCAP2 Antibody [NBP2-47289] - Staining of human duodenum, lung, lymph node and pancreas using Anti-SCAP2 antibody NBP2-47289 (A) shows similar protein distribution across tissues to independent antibody NBP2-47288 (B).](http://images.novusbio.com/fullsize/SCAP2-Antibody-Immunohistochemistry-Paraffin-NBP2-47289-img0016.jpg "Immunohistochemistry-Paraffin: SCAP2 Antibody [NBP2-47289] - Staining of human duodenum, lung, lymph node and pancreas using Anti-SCAP2 antibody NBP2-47289 (A) shows similar protein distribution across tissues to independent antibody NBP2-47288 (B).")
![Immunohistochemistry-Paraffin: SCAP2 Antibody [NBP2-47289] - Staining of human lung shows moderate cytoplasmic positivity in macrophages.](http://images.novusbio.com/fullsize/SCAP2-Antibody-Immunohistochemistry-Paraffin-NBP2-47289-img0017.jpg "Immunohistochemistry-Paraffin: SCAP2 Antibody [NBP2-47289] - Staining of human lung shows moderate cytoplasmic positivity in macrophages.")
![N/A C-Reactive Protein/CRP [Biotin]](https://images.novusbio.com/images2/DATA_CReactive_Protein_DY1707_ELISA_1701.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/DATA_IL6_M6000_ELISA_936.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/IL-6_M6000_ELISA_415.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images/m6000b_mouse-il-6-quantikine-elisa-kit-44202415433118.jpg)
![Western Blot Pentraxin 2/SAP Antibody [Unconjugated]](https://images.novusbio.com/images2/Pentraxin_2_AF2558_Western_Blot_15557.jpg)
![Simple Western Pentraxin 2/SAP Antibody [Unconjugated]](https://images.novusbio.com/images2/Pentraxin_2_AF2558_Simple_Western_17977.jpg)
![Immunocytochemistry PSAP Antibody [Unconjugated]](https://images.novusbio.com/images2/PSAP_AF8520_Immunocytochemistry_16563.jpg)
![Western Blot PSAP Antibody [Unconjugated]](https://images.novusbio.com/images2/PSAP_AF8520_Western_Blot_16593.jpg)
![Simple Western PSAP Antibody [Unconjugated]](https://images.novusbio.com/images2/af8520_human-psap-affinity-purified-polyclonal-ab-simple-western-13420221645.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Western Blot Src [p Tyr419] Antibody [Unconjugated]](https://images.novusbio.com/images2/Src_AF2685_Western_Blot_5209.jpg)
![Simple Western Src [p Tyr419] Antibody [Unconjugated]](https://images.novusbio.com/images2/16327.jpg)
![Immunohistochemistry Src [p Tyr419] Antibody [Unconjugated]](https://images.novusbio.com/images2/Src_AF2685_Immunohistochemistry_7158.jpg)
![N/A Kallikrein 3/PSA [HRP]](https://images.novusbio.com/images2/DATA_Kallikrein_3_DKK300_ELISA_729.jpg)
![N/A Kallikrein 3/PSA [HRP]](https://images.novusbio.com/images2/DATA_Kallikrein_3_DKK300_ELISA_730.jpg)
![N/A Kallikrein 3/PSA [HRP]](https://images.novusbio.com/images2/Kallikrein_3_DKK300_ELISA_124.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")