![Western Blot: PPP6C Antibody [NBP2-13804] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp](http://images.novusbio.com/fullsize/PPP6C-Antibody-Western-Blot-NBP2-13804-img0002.jpg "Western Blot: PPP6C Antibody [NBP2-13804] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: CYRCGNIASIMVFKDVNTREPKLFRAVPDSERVIPPRTTTPYFL |
| Predicted Species | Mouse (100%), Rat (100%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | PPP6C |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP2-13804 | Applications | Species |
|---|---|---|
| Kitamura N, Fujiwara N, Hayakawa K Et al. Protein phosphatase 6 promotes neurite outgrowth by promoting mTORC2 activity in N2a cells Journal of biochemistry 2021-07-26 [PMID: 34314486] |
Secondary Antibodies |
Isotype Controls |
Research Areas for PPP6C Antibody (NBP2-13804)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | PPP6C |
![Immunohistochemistry-Paraffin: PPP6C Antibody [NBP2-13804] - Staining of human tonsil shows moderate cytoplasmic positivity in germinal center cells.](http://images.novusbio.com/fullsize/PPP6C-Antibody-Immunohistochemistry-Paraffin-NBP2-13804-img0006.jpg "Immunohistochemistry-Paraffin: PPP6C Antibody [NBP2-13804] - Staining of human tonsil shows moderate cytoplasmic positivity in germinal center cells.")
![Immunohistochemistry-Paraffin: PPP6C Antibody [NBP2-13804] - Staining of human pancreas shows moderate cytoplasmic positivity in exocrine glandular cells.](http://images.novusbio.com/fullsize/PPP6C-Antibody-Immunohistochemistry-Paraffin-NBP2-13804-img0003.jpg "Immunohistochemistry-Paraffin: PPP6C Antibody [NBP2-13804] - Staining of human pancreas shows moderate cytoplasmic positivity in exocrine glandular cells.")
![Immunohistochemistry-Paraffin: PPP6C Antibody [NBP2-13804] - Staining of human stomach shows moderate to strong granular cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/PPP6C-Antibody-Immunohistochemistry-Paraffin-NBP2-13804-img0004.jpg "Immunohistochemistry-Paraffin: PPP6C Antibody [NBP2-13804] - Staining of human stomach shows moderate to strong granular cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: PPP6C Antibody [NBP2-13804] - Staining of human testis shows weak to moderate cytoplasmic positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/PPP6C-Antibody-Immunohistochemistry-Paraffin-NBP2-13804-img0005.jpg "Immunohistochemistry-Paraffin: PPP6C Antibody [NBP2-13804] - Staining of human testis shows weak to moderate cytoplasmic positivity in cells in seminiferous ducts.")
![Flow Cytometry Annexin V Apoptosis Kit [FITC]](https://images.novusbio.com/images/Annexin-V-Apoptosis-Kit-[FITC]-Flow-Cytometry-NBP2-29373-img0001.jpg)
![Flow Cytometry Annexin V Apoptosis Kit [FITC]](https://images.novusbio.com/images/Annexin-V-Apoptosis-Kit-[FITC]-Flow-Cytometry-NBP2-29373-img0003.jpg)
![Flow Cytometry Annexin V Apoptosis Kit [FITC]](https://images.novusbio.com/images/Annexin-V-Apoptosis-Kit-[FITC]-Flow-Cytometry-NBP2-29373-img0004.jpg)
![Western Blot PP2A alpha [p Tyr307] Antibody [Unconjugated]](https://images.novusbio.com/images2/PP2A_AF3989_Western_Blot_5373.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Western Blot Histone H2AX [p Ser139] Antibody [Unconjugated]](https://images.novusbio.com/images2/Histone_H2AX_AF2288_Western_Blot_5182.jpg)
![Simple Western Histone H2AX [p Ser139] Antibody [Unconjugated]](https://images.novusbio.com/images2/16395.jpg)
![Immunocytochemistry Histone H2AX [p Ser139] Antibody [Unconjugated]](https://images.novusbio.com/images2/Histone_H2AX_AF2288_Immunocytochemistry__Immunofluorescence_16920.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")