| Reactivity | HuSpecies Glossary |
| Applications | AC |
| Description | A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Rad51L1. Source: E. coli Amino Acid Sequence: SIPVILTNQITTHLSGALASQADLVSPADDLSLSEGTSGSSCVIAALGNTWSHSVNTRLILQYLDSERRQI Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source | E. coli |
| Protein/Peptide Type | Recombinant Protein Antigen |
| Gene | RAD51B |
| Purity | >80% by SDS-PAGE and Coomassie blue staining |
| Dilutions |
|
| Application Notes | This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55046. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com For further blocking tide related information and a protocol, click here. |
| Theoretical MW | 25 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS and 1M Urea, pH 7.4. |
| Preservative | No Preservative |
| Purity | >80% by SDS-PAGE and Coomassie blue staining |
Research Areas for Rad51L1 Recombinant Protein Antigen (NBP2-55046PEP)Find related products by research area.
|
|
Breast Cancer and RAD51L1 Antibodies In the United States, breast cancer is one of the most common cancers and the second leading cause of cancer related deaths in women. According to the American Cancer Society's most recent estimates for breast cancer in the United States, there are ab... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | RAD51B |
![Western Blot BRCA2 Antibody (234403) [Unconjugated]](https://images.novusbio.com/images2/BRCA2_MAB2476_Western_Blot_6033.jpg)
![Immunohistochemistry BRCA2 Antibody (234403) [Unconjugated]](https://images.novusbio.com/images2/mab2476_human-brca2-mab-clone-234403-immunohistochemistry-10520211657.jpg)
![Simple Western HMGA2 Antibody [Unconjugated]](https://images.novusbio.com/images2/HMGA2_AF3184_Simple_Western_16679.jpg)
![Western Blot HMGA2 Antibody [Unconjugated]](https://images.novusbio.com/images2/HMGA2_AF3184_Western_Blot_7403.jpg)
![Immunocytochemistry HMGA2 Antibody [Unconjugated]](https://images.novusbio.com/images2/af3184_human-mouse-hmga2-affinity-purified-polyclonal-ab-immunocytochemistry-4122020143513.jpg)
![Immunocytochemistry Progesterone R/NR3C3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Progesterone_R_AF5415_Immunocytochemistry__Immunofluorescence_20674.jpg)
![Immunohistochemistry Progesterone R/NR3C3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Progesterone_R_AF5415_Immunohistochemistry_20779.jpg)
![Western Blot Progesterone R/NR3C3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Progesterone_R_AF5415_Western_Blot_5715.jpg)