![Western Blot: Pyruvate Dehydrogenase Phosphatase/PDP1/PPM2C Antibody [NBP1-82432] - Analysis using Anti-PDP1 antibody NBP1-82432 (A) shows similar pattern to independent antibody NBP1-87308 (B).](http://images.novusbio.com/fullsize/Pyruvate-Dehydrogenase-Phosphatase-PDP1-PPM2C-Antibody-Western-Blot-NBP1-82432-img0010.jpg "Western Blot: Pyruvate Dehydrogenase Phosphatase/PDP1/PPM2C Antibody [NBP1-82432] - Analysis using Anti-PDP1 antibody NBP1-82432 (A) shows similar pattern to independent antibody NBP1-87308 (B).")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: QDKFLVLATDGLWETMHRQDVVRIVGEYLTGMHHQQPIAVGGYKVTLGQMHGLLTERRTKMSSVFEDQNAATHLIRHAVGNNEFGT |
| Predicted Species | Mouse (98%), Rat (98%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | PDP1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot Pyruvate Dehydrogenase E1-alpha subunit [p Ser293] Antibody - BSA Free](https://images.novusbio.com/images/Pyruvate-Dehydrogenase-E1-alpha-subunit-[p-Ser293]-Antibody-Western-Blot-NB110-93479-img0003.jpg)
![Western Blot Pyruvate Dehydrogenase E1-alpha subunit [p Ser293] Antibody - BSA Free](https://images.novusbio.com/images/Pyruvate-Dehydrogenase-E1-alpha-subunit-[p-Ser293]-Antibody-Western-Blot-NB110-93479-img0008.jpg)
![Western Blot Pyruvate Dehydrogenase E1-alpha subunit [p Ser293] Antibody - BSA Free](https://images.novusbio.com/images/Pyruvate-Dehydrogenase-E1-alpha-subunit-[p-Ser293]-Antibody-Western-Blot-NB110-93479-img0007.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | PDP1 |
![Immunocytochemistry/Immunofluorescence: Pyruvate Dehydrogenase Phosphatase/PDP1/PPM2C Antibody [NBP1-82432] - Staining of human cell line U-2 OS shows localization to nucleoplasm, cytosol & mitochondria. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/Pyruvate-Dehydrogenase-Phosphatase-PDP1-PPM2C-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-82432-img0008.jpg "Immunocytochemistry/Immunofluorescence: Pyruvate Dehydrogenase Phosphatase/PDP1/PPM2C Antibody [NBP1-82432] - Staining of human cell line U-2 OS shows localization to nucleoplasm, cytosol & mitochondria. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: Pyruvate Dehydrogenase Phosphatase/PDP1/PPM2C Antibody [NBP1-82432] - Staining of human heart muscle shows moderate cytoplasmic positivity in myocytes.](http://images.novusbio.com/fullsize/Pyruvate-Dehydrogenase-Phosphatase-PDP1-PPM2C-Antibody-Immunohistochemistry-Paraffin-NBP1-82432-img0009.jpg "Immunohistochemistry-Paraffin: Pyruvate Dehydrogenase Phosphatase/PDP1/PPM2C Antibody [NBP1-82432] - Staining of human heart muscle shows moderate cytoplasmic positivity in myocytes.")
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Western Blot Butyrylcholinesterase/BCHE Antibody [Unconjugated]](https://images.novusbio.com/images2/Butyrylcholinesterase_AF9024_Western_Blot_19121.jpg)
![Immunohistochemistry Butyrylcholinesterase/BCHE Antibody [Unconjugated]](https://images.novusbio.com/images2/Butyrylcholinesterase_AF9024_Immunohistochemistry_19158.jpg)
![Western Blot Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Western_Blot_5287.jpg)
![Simple Western Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Simple_Western_16990.jpg)
![Knockout Validated Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Knockout_Validated_24032.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")