Reactivity | HuSpecies Glossary |
Applications | WB, ELISA, IHC |
Clone | 5F8 |
Clonality | Monoclonal |
Host | Mouse |
Conjugate | Unconjugated |
Description | Quality control test: Antibody Reactive Against Recombinant Protein. |
Immunogen | PDK2 (AAH05811, 187 a.a. ~ 276 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. HIGSIDPNCNVSEVVKDAYDMAKLLCDKYYMASPDLEIQEINAANSKQPIHMVYVPSHLYHMLFELFKNAMRATVESHESSLILPPIKVM |
Specificity | PDK2 (5F8) |
Isotype | IgG2a Kappa |
Clonality | Monoclonal |
Host | Mouse |
Gene | PDK2 |
Purity | Protein A purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
||
Application Notes | WB usage on cell lysate and recombinant protein reported in scientific literature (PMID: 22123926). |
||
Control |
|
||
Reviewed Applications |
|
||
Publications |
|
Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer | In 1x PBS, pH 7.4 |
Preservative | No Preservative |
Purity | Protein A purified |
Publication using H00005164-M02 | Applications | Species |
---|---|---|
Contractor T, Harris CR. p53 negatively regulates transcription of the pyruvate dehydrogenase kinase Pdk2. Cancer Research. 2011-11-28 [PMID: 22123926] |
Images | Ratings | Applications | Species | Date | Details | ||||||
---|---|---|---|---|---|---|---|---|---|---|---|
reviewed by:
Verified Customer |
WB | Human | 08/22/2015 |
Summary
|
Secondary Antibodies |
Isotype Controls |
Research Areas for PDK2 Antibody (H00005164-M02)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.