Home » PUF60 » PUF60 Proteins » PUF60 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

PUF60 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for PUF60 Recombinant Protein Antigen (NBP2-49032PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

PUF60 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PUF60.

Source: E. coli

Amino Acid Sequence: AATAKITAQEAVAGAAVLGTLGTPGLVSPALTLAQPLGTLPQAVMAAQAPGVITGVTPARPPIPVTIPSVGVVNPILASPPTL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PUF60
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-49032.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.
Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PUF60 Recombinant Protein Antigen

  • FBP interacting repressor
  • FBP-interacting repressor
  • FIRpoly-U binding splicing factor PUF60
  • FLJ31379
  • FUSE-binding protein-interacting repressor
  • poly(U)-binding-splicing factor PUF60
  • poly-U binding splicing factor 60KDa
  • Ro ribonucleoprotein binding protein 1
  • Ro ribonucleoprotein-binding protein 1
  • Ro-binding protein 1
  • roBP1
  • RoBPI
  • siah binding protein 1,60 kDa poly(U)-binding-splicing factor
  • Siah-binding protein 1
  • siah-BP1
  • SIAHBP1pyrimidine tract binding splicing factor

Background

PUF60 is a Ro RNP-binding protein. It interacts with Ro RNPs and their interaction is thought to represent a gain of function for Ro RNPs. PUF60 also forms a ternary complex with far upstream element (FUSE) and FUSE-binding protein. It can repress a c-myc reporter via the FUSE. It is also known to target transcription factor IIH and inhibit activated transcription. PUF60 gene is implicated in the xeroderma pigmentosum disorder. There are two alternatively spliced transcript variants of this gene encoding different isoforms. There seems to be evidence of multiple polyadenylation sites for PUF60 gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

c-Myc Antibody
(9E10) - BSA Free
NB600-302
Flow Cytometry c-Myc Antibody (9E10) - BSA Free
Flow Cytometry c-Myc Antibody (9E10) - BSA Free
Western Blot c-Myc Antibody (9E10) - BSA Free
(4 Reviews)
(46 Publications)
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
XPB Antibody
NB100-61060
Immunoprecipitation XPB Antibody
Western Blot XPB Antibody
Western Blot XPB Antibody
(1 Review)
(3 Publications)
Species: Hu, Mu, Rb, V-Vi
Applications: ChIP, IP, WB
FUBP1 Antibody
NBP1-83918
Immunocytochemistry/ Immunofluorescence FUBP1 Antibody
Immunohistochemistry-Paraffin FUBP1 Antibody
Immunohistochemistry-Paraffin FUBP1 Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
GTF2H5
Overexpression Lysate
NBL1-11392
Western Blot GTF2H5 Overexpression Lysate
Species: Hu
Applications: WB
GTF2H4 Antibody
H00002968-B01P
Western Blot GTF2H4 Antibody
Immunocytochemistry/ Immunofluorescence GTF2H4 Antibody
Species: Hu
Applications: ICC/IF, WB
GTF2H2 Antibody
(PCRP-GTF2H2-1B9)
NBP3-07348
Protein Array GTF2H2 Antibody (PCRP-GTF2H2-1B9)
Flow Cytometry GTF2H2 Antibody (PCRP-GTF2H2-1B9)
Immunocytochemistry/ Immunofluorescence GTF2H2 Antibody (PCRP-GTF2H2-1B9)
Species: Hu
Applications: Flow, ICC/IF, PA
GTF2H3 Antibody
NBP2-87539
Immunohistochemistry-Paraffin GTF2H3 Antibody
Western Blot GTF2H3 Antibody
Immunohistochemistry GTF2H3 Antibody
Species: Hu
Applications: IHC, IHC-P, WB
GTF2H1 Antibody
(1F12-1B5)
H00002965-M01
Western Blot GTF2H1 Antibody (1F12-1B5)
Immunocytochemistry/ Immunofluorescence GTF2H1 Antibody (1F12-1B5)
Immunohistochemistry-Paraffin GTF2H1 Antibody (1F12-1B5)
(2 Publications)
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, S-ELISA, WB
FBPase 1 Antibody
NBP1-84721
Immunohistochemistry-Paraffin FBPase 1 Antibody
Immunohistochemistry-Paraffin FBPase 1 Antibody
Immunohistochemistry-Paraffin FBPase 1 Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, Simple Western, WB
RAB14 Antibody
NBP1-84720
Immunocytochemistry/ Immunofluorescence RAB14 Antibody
Western Blot RAB14 Antibody
Immunohistochemistry-Paraffin RAB14 Antibody
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
FOLR1 Antibody
(548908) [Unconjugate
MAB5646
Flow Cytometry FOLR1 Antibody (548908) [Unconjugated]
Western Blot FOLR1 Antibody (548908) [Unconjugated]
Immunocytochemistry FOLR1 Antibody (548908) [Unconjugated]
(2 Reviews)
(12 Publications)
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, KO, WB
FOLR2 Antibody
AF5697
Immunocytochemistry FOLR2 Antibody
Western Blot FOLR2 Antibody
(4 Publications)
Species: Hu
Applications: ICC, WB
MARCH8 Antibody
NBP1-85540
Western Blot MARCH8 Antibody
Immunohistochemistry-Paraffin MARCH8 Antibody
Immunohistochemistry-Paraffin MARCH8 Antibody
Species: Hu
Applications: IHC, IHC-P, WB
MLXIP Antibody
NBP2-85297
Immunohistochemistry-Paraffin MLXIP Antibody
Western Blot MLXIP Antibody
Western Blot MLXIP Antibody
Species: Hu
Applications: IHC, IHC-P, WB
MYLIP Antibody
(OTI3A2)
NBP2-46069
Western Blot MYLIP Antibody (OTI3A2)
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB
SAP155 Antibody
(6C7)
NBP3-26326
Immunohistochemistry SAP155 Antibody (6C7)
Immunohistochemistry SAP155 Antibody (6C7)
Western Blot SAP155 Antibody (6C7)
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, WB
HO-1/HMOX1/HSP32
Antibody (HO-1-1)
NBP1-97507
Flow Cytometry HO-1/HMOX1/HSP32 Antibody (HO-1-1)
Immunohistochemistry-Paraffin HO-1/HMOX1/HSP32 Antibody (HO-1-1)
Western Blot HO-1/HMOX1/HSP32 Antibody (HO-1-1)
(1 Review)
(20 Publications)
Species: Bv, Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
FARP2 Antibody
NBP1-84680
Western Blot FARP2 Antibody
Immunohistochemistry-Paraffin FARP2 Antibody
Species: Hu
Applications: IHC, IHC-P, WB
Calreticulin
Antibody - BSA Free
NB600-101
Knockdown Validated Calreticulin Antibody - BSA Free
Western Blot Calreticulin Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence Calreticulin Antibody - BSA Free
(28 Publications)
Species: Bv, Ha, Hu, Mu, Pm, Rt
Applications: B/N, DB, EM, Flow, ICC/IF, IHC, IHC-P, IP, KD, PA, Simple Western, WB
SSB Antibody
(OTI2C8)
NBP1-48002
Western Blot SSB Antibody (OTI2C8)
Immunohistochemistry-Paraffin SSB Antibody (OTI2C8)
Immunohistochemistry-Paraffin SSB Antibody (OTI2C8)
Species: Ca, Hu, Pm, Pm
Applications: ICC/IF, IHC, IHC-P, IP, WB

Publications for PUF60 Recombinant Protein Antigen (NBP2-49032PEP) (0)

There are no publications for PUF60 Recombinant Protein Antigen (NBP2-49032PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PUF60 Recombinant Protein Antigen (NBP2-49032PEP) (0)

There are no reviews for PUF60 Recombinant Protein Antigen (NBP2-49032PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PUF60 Recombinant Protein Antigen (NBP2-49032PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PUF60 Products

Blogs on PUF60

There are no specific blogs for PUF60, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Flow Cytometry: c-Myc Antibody (9E10) [NB600-302] - An intracellular stain was performed on U-937 cells with c-Myc Antibody (9E10) NB600-302AF488 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 10 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 488.
c-Myc Antibody (9E10) - BSA Free
NB600-302

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PUF60 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol PUF60