Home » PTRF » PTRF Proteins » PTRF Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

PTRF Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for PTRF Recombinant Protein Antigen (NBP2-57490PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

PTRF Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PTRF.

Source: E. coli

Amino Acid Sequence: VSVNVKTVRGSLERQAGQIKKLEVNEAELLRRRNFKVMIYQDEVKLPAKLSISKSLKESEALPEKEGEELGEGERPEEDAAALELSSD

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CAVIN1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57490.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PTRF Recombinant Protein Antigen

  • CAVIN
  • cavin-1
  • CGL4
  • FLJ90031
  • polymerase I and transcript release factor
  • RNA polymerase I and transcript release factor
  • TTF-I interacting peptide 12

Background

PTRF (polymerase I and transcript release factor) was first identified as a TTF-I and RNA polymerase I (RNA Pol I) interacting protein that functions in the termination of RNA polymerase I transcription. PTRF has also been described as a protein that localizes to the plasma membrane and caveolae of adipocytes and whose localization is under the control of insulin. In this context, PTRF has been observed to associate with a lipase and have an extranuclear role in the regulation of lipolysis. PTRF is also known as FKSG13.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Caveolin-1
Antibody (7C8)
NB100-615
Flow Cytometry Caveolin-1 Antibody (7C8)
Flow Cytometry Caveolin-1 Antibody (7C8)
Immunocytochemistry/ Immunofluorescence Caveolin-1 Antibody (7C8)
(3 Reviews)
(37 Publications)
Species: Hu, Mu, Rt, Sh
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
SDPR Antibody
AF5759
Western Blot SDPR Antibody
(6 Publications)
Species: Hu, Mu
Applications: WB
Caveolin-3 Antibody
NB110-5029
Immunocytochemistry/ Immunofluorescence Caveolin-3 Antibody
Immunocytochemistry/ Immunofluorescence Caveolin-3 Antibody
Immunohistochemistry-Paraffin Caveolin-3 Antibody
(2 Publications)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
Caveolin-2 Antibody
NBP1-31116
Immunohistochemistry-Paraffin Caveolin-2 Antibody
Western Blot Caveolin-2 Antibody
Immunocytochemistry/ Immunofluorescence Caveolin-2 Antibody
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
PRKCDBP Antibody
NBP1-45210
Immunohistochemistry-Paraffin PRKCDBP Antibody
Western Blot PRKCDBP Antibody
Western Blot PRKCDBP Antibody
(2 Publications)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, PEP-ELISA, WB
p21/CIP1/CDKN1A
Antibody (WA-1)
NBP2-29463
Immunohistochemistry-Paraffin p21/CIP1/CDKN1A Antibody (WA-1)
(24 Publications)
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Immunocytochemistry Insulin Antibody (182410) [Unconjugated]
Immunohistochemistry Insulin Antibody (182410) [Unconjugated]
(24 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
MURC Antibody
NBP1-86609
Immunohistochemistry-Paraffin MURC Antibody
Immunohistochemistry-Paraffin MURC Antibody
Immunohistochemistry-Paraffin MURC Antibody
(1 Publication)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
p53 Antibody (PAb
240) - BSA Free
NB200-103
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow (Intracellular) p53 Antibody (PAb 240) - BSA Free
(3 Reviews)
(42 Publications)
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Calpain 3 Antibody
NBP3-35199
Western Blot Calpain 3 Antibody
Immunocytochemistry/ Immunofluorescence Calpain 3 Antibody
Species: Mu, Rt
Applications: ELISA, ICC/IF, WB
Dysferlin Antibody
(JF05-54)
NBP2-66814
Immunohistochemistry-Paraffin Dysferlin Antibody (JF05-54)
Immunohistochemistry-Paraffin Dysferlin Antibody (JF05-54)
Immunohistochemistry-Paraffin Dysferlin Antibody (JF05-54)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
TCEAL1 Antibody
(OTI2G10)
NBP2-46085
Immunohistochemistry TCEAL1 Antibody (OTI2G10)
Immunohistochemistry TCEAL1 Antibody (OTI2G10)
Immunohistochemistry TCEAL1 Antibody (OTI2G10)
Species: Hu
Applications: IHC, IHC-P, WB
Dynamin 2 Antibody
NBP2-47477
Immunocytochemistry/ Immunofluorescence Dynamin 2 Antibody
Immunohistochemistry-Paraffin Dynamin 2 Antibody
Immunohistochemistry-Paraffin Dynamin 2 Antibody
(3 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KO, WB
PACSIN2 Antibody
NBP2-24481
Immunohistochemistry-Paraffin PACSIN2 Antibody
Western Blot PACSIN2 Antibody
Western Blot PACSIN2 Antibody
Species: Hu, Pm, Xp
Applications: IHC, IHC-P, WB
IGF-I/IGF-1
[Unconjugated]
291-G1
SDS-PAGE IGF-I/IGF-1 [Unconjugated]
Bioactivity IGF-I/IGF-1 [Unconjugated]
Mass Spectrometry IGF-I/IGF-1 [Unconjugated]
(224 Publications)
Species: Hu
Applications: BA
RAB8A Antibody
(3G1)
H00004218-M02
Immunocytochemistry/ Immunofluorescence RAB8A Antibody (3G1)
ELISA RAB8A Antibody (3G1)
Western Blot RAB8A Antibody (3G1)
(1 Review)
(9 Publications)
Species: Hu, Mu, Ze
Applications: ELISA, ICC/IF, IHC, WB
RNA polymerase I
termination factor An ...
NBP3-27122
Immunohistochemistry RNA polymerase I termination factor Antibody (2F4D8)
Western Blot RNA polymerase I termination factor Antibody (2F4D8)
ELISA RNA polymerase I termination factor Antibody (2F4D8)
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
CD2 Antibody
(RPA-2.10)
NBP2-25200
Flow Cytometry CD2 Antibody (RPA-2.10)
Flow Cytometry CD2 Antibody (RPA-2.10)
Flow Cytometry CD2 Antibody (RPA-2.10)
(1 Review)
Species: Hu
Applications: B/N, Flow, IHC, IHC-Fr, WB
D4S234E Antibody
(1C3)
H00027065-M01
Sandwich ELISA D4S234E Antibody (1C3)
Western Blot D4S234E Antibody (1C3)
Western Blot D4S234E Antibody (1C3)
(1 Publication)
Species: Hu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
Seipin/BSCL2
Antibody
AF7385
Western Blot Seipin/BSCL2 Antibody
Immunocytochemistry Seipin/BSCL2 Antibody
Species: Hu
Applications: ICC, WB

Publications for PTRF Recombinant Protein Antigen (NBP2-57490PEP) (0)

There are no publications for PTRF Recombinant Protein Antigen (NBP2-57490PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PTRF Recombinant Protein Antigen (NBP2-57490PEP) (0)

There are no reviews for PTRF Recombinant Protein Antigen (NBP2-57490PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PTRF Recombinant Protein Antigen (NBP2-57490PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PTRF Products

Research Areas for PTRF Recombinant Protein Antigen (NBP2-57490PEP)

Find related products by research area.

Blogs on PTRF

There are no specific blogs for PTRF, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Flow Cytometry: p53 Antibody (PAb 240) [NB200-103] - An intracellular stain was performed on HeLa cells with p53 (PAb240) NB200-103AF647 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647.
p53 Antibody (PAb 240) - BSA Free
NB200-103

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PTRF Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol CAVIN1