![Immunohistochemistry-Paraffin: MURC Antibody [NBP1-86609] - Staining in human skeletal muscle and pancreas tissues using anti-MURC antibody. Corresponding MURC RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/MURC-Antibody-Immunohistochemistry-Paraffin-NBP1-86609-img0006.jpg "Immunohistochemistry-Paraffin: MURC Antibody [NBP1-86609] - Staining in human skeletal muscle and pancreas tissues using anti-MURC antibody. Corresponding MURC RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KGKDRTVAEGEECAREMGVDIIARSESLGPISELYSDELSEPEHEAARPVYPPHEGREIPTPEPLKVTFKSQVKVEDDESLLL |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | MURC |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation/Permeabilization: PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Simple Western EphB2 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphB2_AF467_Simple_Western_21454.jpg)
![Western Blot EphB2 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphB2_AF467_Western_Blot_21511.jpg)
![Immunocytochemistry EphB2 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphB2_AF467_Immunocytochemistry__Immunofluorescence_17288.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | MURC |
![Immunohistochemistry-Paraffin: MURC Antibody [NBP1-86609] - Staining of human cerebral cortex, colon, pancreas and skeletal muscle using Anti-MURC antibody NBP1-86609 (A) shows similar protein distribution across tissues to independent antibody NBP1-86608 (B).](http://images.novusbio.com/fullsize/MURC-Antibody-Immunohistochemistry-Paraffin-NBP1-86609-img0010.jpg "Immunohistochemistry-Paraffin: MURC Antibody [NBP1-86609] - Staining of human cerebral cortex, colon, pancreas and skeletal muscle using Anti-MURC antibody NBP1-86609 (A) shows similar protein distribution across tissues to independent antibody NBP1-86608 (B).")
![Western Blot: MURC Antibody [NBP1-86609] - Analysis in control (vector only transfected HEK293T lysate) and MURC over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize/MURC-Antibody-Western-Blot-NBP1-86609-img0009.jpg "Western Blot: MURC Antibody [NBP1-86609] - Analysis in control (vector only transfected HEK293T lysate) and MURC over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).")
![Immunocytochemistry/Immunofluorescence: MURC Antibody [NBP1-86609] - Staining of human cell line RH-30 shows localization to nucleoplasm, plasma membrane & the Golgi apparatus. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/MURC-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-86609-img0008.jpg "Immunocytochemistry/Immunofluorescence: MURC Antibody [NBP1-86609] - Staining of human cell line RH-30 shows localization to nucleoplasm, plasma membrane & the Golgi apparatus. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: MURC Antibody [NBP1-86609] - Staining of human colon.](http://images.novusbio.com/fullsize/MURC-Antibody-Immunohistochemistry-Paraffin-NBP1-86609-img0012.jpg "Immunohistochemistry-Paraffin: MURC Antibody [NBP1-86609] - Staining of human colon.")
![Immunohistochemistry-Paraffin: MURC Antibody [NBP1-86609] - Staining of human pancreas shows low expression as expected.](http://images.novusbio.com/fullsize/MURC-Antibody-Immunohistochemistry-Paraffin-NBP1-86609-img0004.jpg "Immunohistochemistry-Paraffin: MURC Antibody [NBP1-86609] - Staining of human pancreas shows low expression as expected.")
![Immunohistochemistry-Paraffin: MURC Antibody [NBP1-86609] - Staining of human skeletal muscle shows high expression.](http://images.novusbio.com/fullsize/MURC-Antibody-Immunohistochemistry-Paraffin-NBP1-86609-img0005.jpg "Immunohistochemistry-Paraffin: MURC Antibody [NBP1-86609] - Staining of human skeletal muscle shows high expression.")
![Immunohistochemistry-Paraffin: MURC Antibody [NBP1-86609] - Staining of human cerebral cortex.](http://images.novusbio.com/fullsize/MURC-Antibody-Immunohistochemistry-Paraffin-NBP1-86609-img0011.jpg "Immunohistochemistry-Paraffin: MURC Antibody [NBP1-86609] - Staining of human cerebral cortex.")
![Western Blot ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Western_Blot_5097.jpg)
![Immunohistochemistry ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Immunohistochemistry_20696.jpg)
![Knockout Validated ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Knockout_Validated_22864.jpg)
![Immunohistochemistry Myosin Heavy Chain Antibody (MF20) [Unconjugated]](https://images.novusbio.com/images2/Myosin_Heavy_Chain_MAB4470_Immunohistochemistry_22971.jpg)
![Immunohistochemistry Myosin Heavy Chain Antibody (MF20) [Unconjugated]](https://images.novusbio.com/images2/Myosin_Heavy_Chain_MAB4470_Immunohistochemistry_22972.jpg)
![Immunocytochemistry Myosin Heavy Chain Antibody (MF20) [Unconjugated]](https://images.novusbio.com/images2/Myosin_Heavy_Chain_MAB4470_Immunocytochemistry_9890.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")