![Western Blot: PTHLH/PTHrP Antibody [NBP1-59322] - HepG2 cell lysate, Antibody Titration: 2.0ug/ml](http://images.novusbio.com/fullsize/PTHLH-PTHrP-Antibody-Western-Blot-NBP1-59322-img0001.jpg "Western Blot: PTHLH/PTHrP Antibody [NBP1-59322] - HepG2 cell lysate, Antibody Titration: 2.0ug/ml")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Concentration | 1 mg/ml |
| Description | The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution. |
| Immunogen | Synthetic peptides corresponding to PTHLH (parathyroid hormone-like hormone) The peptide sequence was selected from the middle region of PTHLH. Peptide sequence YKEQPLKTPGKKKKGKPGKRKEQEKKKRRTRSAWLDSGVTGSGLEGDHLS. The peptide sequence for this immunogen was taken from within the described region. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | PTHLH |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Theoretical MW | 20 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
|
| Reviewed Applications |
|
|
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 1 mg/ml |
| Purity | Protein A purified |
![Immunohistochemistry PTH Antibody (918462) [Unconjugated]](https://images.novusbio.com/images2/PTH_MAB7665_Immunohistochemistry_16650.jpg)
![Western Blot PTH Antibody (918462) [Unconjugated]](https://images.novusbio.com/images2/PTH_MAB7665_Western_Blot_16656.jpg)
| Images | Ratings | Applications | Species | Date | Details | ||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
reviewed by:
Verified Customer |
WB | Human | 11/03/2023 |
Summary
|
Secondary Antibodies |
Isotype Controls |
Research Areas for PTHLH/PTHrP Antibody (NBP1-59322)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: PTHLH/PTHrP Antibody [NBP1-59322] - Human Lung Alveolar cells (indicated with arrows), 4-8ug/ml.](http://images.novusbio.com/fullsize/PTHLH-PTHrP-Antibody-Immunohistochemistry-Paraffin-NBP1-59322-img0003.jpg "Immunohistochemistry-Paraffin: PTHLH/PTHrP Antibody [NBP1-59322] - Human Lung Alveolar cells (indicated with arrows), 4-8ug/ml.")
![Western Blot: PTHLH/PTHrP Antibody [NBP1-59322] - Primary, Antibody Dilution: 1 : 1000 Secondary Antibody: Goat anti-rabbit HRP Secondary, Antibody Dilution: 1 : 2000.](http://images.novusbio.com/fullsize/PTHLH-PTHrP-Antibody-Western-Blot-NBP1-59322-img0004.jpg "Western Blot: PTHLH/PTHrP Antibody [NBP1-59322] - Primary, Antibody Dilution: 1 : 1000 Secondary Antibody: Goat anti-rabbit HRP Secondary, Antibody Dilution: 1 : 2000.")
![Immunohistochemistry-Paraffin: PTHLH/PTHrP Antibody [NBP1-59322] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.](http://images.novusbio.com/fullsize/PTHLH-PTHrP-Antibody-Immunohistochemistry-Paraffin-NBP1-59322-img0002.jpg "Immunohistochemistry-Paraffin: PTHLH/PTHrP Antibody [NBP1-59322] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.")
![Western Blot: Rabbit Polyclonal PTHLH/PTHrP Antibody [NBP1-59322] - The expression level of PTHLH/PTHrP in several kinds of lung cancer cell lines and in lung cancer tissues. Image from a verified customer review.](http://images.novusbio.com/fullsize/antibody/nbp1-59322_rabbit-polyclonal-pthlh-pthrp-antibody-western-blot-711202315580..png "Western Blot: Rabbit Polyclonal PTHLH/PTHrP Antibody [NBP1-59322] - The expression level of PTHLH/PTHrP in several kinds of lung cancer cell lines and in lung cancer tissues. Image from a verified customer review.")
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![N/A Osteoprotegerin/TNFRSF11B [Biotin]](https://images.novusbio.com/images2/DATA_Osteoprotegerin_DY805_ELISA_2238.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
