PTGER2 Antibody (2G10L6) Summary
Additional Information |
Recombinant Monoclonal Antibody |
Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 259-358 of human PTGER2 (P43116). ETDHLILLAIMTITFAVCSLPFTIFAYMNETSSRKEKWDLQALRFLSINSIIDPWVFAILRPPVLRLMRSVLCCRISLRTQDATQTSCSTQSDASKQADL |
Isotype |
IgG |
Clonality |
Monoclonal |
Host |
Rabbit |
Gene |
PTGER2 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin
- Western Blot 1:500 - 1:2000
|
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS, 0.05% BSA, 50% glycerol, pH7.3 |
Preservative |
0.02% Sodium Azide |
Purity |
Affinity purified |
Alternate Names for PTGER2 Antibody (2G10L6)
Background
Prostaglandin E2, a member of the autacoid family of lipid mediators, is a major renal cyclooxygenase product of arachidonic acid metabolism.Prostaglandin E2 binds to four G protein-coupled E-prostanoid receptors,designated EP1, EP2, EP3 and EP4. The expression and function of the prostaglandin E2 receptors have been highly characterized in kidney. EP1,which is predominantly expressed in the collecting duct, couples to Gq proteins to inhibit sodium absorption and increase in intracellular calcium, which act as second messengers. EP2 is coupled to Gs proteins, which stimulate adenylyl cyclase. EP2 has the lowest expression in kidney, but EP2 knockout mice exhibit salt-sensitive hypertension, which suggests a role for EP2 in salt excretion. EP3 is expressed in renal vessels, thick ascending limb and collecting duct. EP3 has at least 6 alternative splice variants that couple to Gi proteins to inhibit cAMP, which subsequently inhibit sodium and water transport. In uterus, EP3 induces the contraction of uterine smooth muscles.EP4 is expressed in glomerulus and collecting duct. It couples to Gs proteins,which stimulate adenylyl cyclase and regulate glomerular tone and renal renin release.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Bv, Hu, Pm, Pm
Applications: IHC, IHC-P
Species: Bt, Hu, Pm, Pm
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Rt
Applications: IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu
Applications: BA
Species: Eq, Hu, Pm, Po, Pm
Applications: ICC, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu, Mu, Ze
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: Flow, ICC/IF, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
Publications for PTGER2 Antibody (NBP3-16740) (0)
There are no publications for PTGER2 Antibody (NBP3-16740).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for PTGER2 Antibody (NBP3-16740) (0)
There are no reviews for PTGER2 Antibody (NBP3-16740).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for PTGER2 Antibody (NBP3-16740) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional PTGER2 Products
Research Areas for PTGER2 Antibody (NBP3-16740)
Find related products by research area.
|
Blogs on PTGER2