Home » PRL-2/PTP4A2 » PRL-2 Antibodies » PRL-2/PTP4A2 Antibody - Azide and BSA Free
Novus Biologicals products are now on bio-techne.com

PRL-2/PTP4A2 Antibody - Azide and BSA Free

 Submit a Review

Images

 
(
Enlarge)
Western Blot: PRL-2/PTP4A2 Antibody [NBP2-93937] - Analysis of extracts of various cell lines, using PRL-2/PTP4A2 at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit . Exposure time: 30s.
Western Blot: PRL-2/PTP4A2 Antibody [NBP2-93937] - Analysis of extracts of various cell lines, using PRL-2/PTP4A2 at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. ...read more
Immunocytochemistry/ Immunofluorescence: PRL-2/PTP4A2 Antibody [NBP2-93937] - Analysis of C6 cells using PRL-2/PTP4A2 at dilution of 1:100. Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: PRL-2/PTP4A2 Antibody [NBP2-93937] - Rat kidney using PTP4A2 antibody at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing ...read more
Immunohistochemistry-Paraffin: PRL-2/PTP4A2 Antibody [NBP2-93937] - Human colon using PTP4A2 antibody at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing ...read more
Immunohistochemistry-Paraffin: PRL-2/PTP4A2 Antibody [NBP2-93937] - Mouse lung using PTP4A2 antibody at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
Azide and BSA Free

Order Details

View Available Formulations
Catalog# & Formulation Size Price
Azide and BSA Free
NBP2-93937-0.02ml
Novus Biologicals offers 100% Guarantee

PRL-2/PTP4A2 Antibody - Azide and BSA Free Summary

Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 30-100 of human PTP4A2 (NP_536316.1). FTEELKKYGVTTLVRVCDATYDKAPVEKEGIHVLDWPFDDGAPPPNQIVDDWLNLLKTKFREEPGCCVAVH
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PTP4A2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 1:50-1:200
  • Immunohistochemistry 1:50-1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:200-1:2000
Theoretical MW
19 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.3), 50% glycerol
Preservative
0.01% Thimerosal
Purity
Affinity purified

Alternate Names for PRL-2/PTP4A2 Antibody - Azide and BSA Free

  • EC 3.1.3.48
  • HH13
  • HH7-2
  • HU-PP-1
  • HU-PP-1HH13
  • OV-1
  • OV-1PTP4A
  • PRL2
  • PRL-2
  • PRL-2HH7-2
  • PRL2protein tyrosine phosphatase IVA
  • protein tyrosine phosphatase IVA2
  • protein tyrosine phosphatase type IVA 2
  • protein tyrosine phosphatase type IVA, member 2
  • Protein-tyrosine phosphatase 4a2
  • Protein-tyrosine phosphatase of regenerating liver 2
  • PTP(CAAXII)
  • PTP4A2
  • PTPCAAX2
  • PTPCAAX2phosphatase of regenerating liver 2
  • ptp-IV1a
  • ptp-IV1b

Background

PTP4A2 is encoded by this gene belongs to a small class of the protein tyrosine phosphatase (PTP) family. PTPs are cell signaling molecules that play regulatory roles in a variety of cellular processes. PTPs in this class contain a protein tyrosine phosphatase catalytic domain and a characteristic C-terminal prenylation motif. This PTP has been shown to primarily associate with plasmic and endosomal membrane through its C-terminal prenylation. This PTP was found to interact with the beta-subunit of Rab geranylgeranyltransferase II (beta GGT II), and thus may function as a regulator of GGT II activity. Overexpression of this gene in mammalian cells conferred a transformed phenotype, which suggested its role in tumorigenesis. Alternatively spliced transcript variants that encode two distinct isoforms have been described. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

PTP4A1 Antibody
NBP3-41338
Western Blot PTP4A1 Antibody
Immunohistochemistry-Paraffin PTP4A1 Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
PRL-3/PTP4A3
Antibody (334402)
MAB3219
Western Blot PRL-3/PTP4A3 Antibody (334402)
(7 Publications)
Species: Hu, Mu, Rt
Applications: WB
Prolactin Antibody
[Unconjugated]
AF1445
Neutralization Prolactin Antibody [Unconjugated]
Western Blot Prolactin Antibody [Unconjugated]
Immunohistochemistry Prolactin Antibody [Unconjugated]
(7 Publications)
Species: Mu, Rt
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, Simple Western, WB
PBX1 Antibody (4A2)
H00005087-M01
Western Blot PBX1 Antibody (4A2)
Immunocytochemistry/ Immunofluorescence PBX1 Antibody (4A2)
Immunohistochemistry-Paraffin PBX1 Antibody (4A2)
(12 Publications)
Species: Hu, Pm, Mu
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA, WB
Reg1A Antibody
(431202) [Unconjugate
MAB4937
Intracellular Staining by Flow Cytometry Reg1A Antibody (431202) [Unconjugated]
(2 Publications)
Species: Hu
Applications: CyTOF-ready, ICFlow, WB
PTEN Antibody
[Unconjugated]
AF847
Western Blot PTEN Antibody [Unconjugated]
Simple Western PTEN Antibody [Unconjugated]
Knockout Validated PTEN Antibody [Unconjugated]
(16 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, KO, Simple Western, WB
PTP pi/PTPRU
Antibody (764209)
MAB7475
Western Blot PTP pi/PTPRU Antibody (764209)
Western Blot PTP pi/PTPRU Antibody (764209)
(4 Publications)
Species: Hu, Rt
Applications: WB
SLC25A3 Antibody
H00005250-B02P
Immunocytochemistry/ Immunofluorescence SLC25A3 Antibody
Western Blot SLC25A3 Antibody
Western Blot SLC25A3 Antibody
(1 Publication)
Species: Hu
Applications: ICC/IF, WB
ERK2 Antibody
[Unconjugated]
AF1230
Western Blot ERK2 Antibody [Unconjugated]
Immunohistochemistry ERK2 Antibody [Unconjugated]
Knockout Validated ERK2 Antibody [Unconjugated]
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
AKT [p Ser473]
Antibody [Unconjugate ...
AF887
Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
(50 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
p21/CIP1/CDKN1A
Antibody (WA-1)
NBP2-29463
Immunohistochemistry-Paraffin p21/CIP1/CDKN1A Antibody (WA-1)
(24 Publications)
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
ERK1 Antibody
(1E5) - BSA Free
NBP2-22203
Flow Cytometry ERK1 Antibody (1E5) - BSA Free
Immunocytochemistry/ Immunofluorescence ERK1 Antibody (1E5) - BSA Free
Immunohistochemistry-Paraffin ERK1 Antibody (1E5) - BSA Free
(1 Publication)
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
PROL1 Antibody
NBP2-38075
Immunohistochemistry PROL1 Antibody
Species: Hu
Applications: IHC, IHC-P
PLRG1 Antibody
NBP1-06556
Immunohistochemistry PLRG1 Antibody
Western Blot PLRG1 Antibody
Immunocytochemistry/ Immunofluorescence PLRG1 Antibody
(1 Review)
(2 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
ASC/TMS1 Antibody
- BSA Free
NBP1-78977
Immunocytochemistry/ Immunofluorescence ASC/TMS1 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence ASC/TMS1 Antibody - BSA Free
Immunohistochemistry ASC/TMS1 Antibody - BSA Free
(2 Reviews)
(53 Publications)
Species: Hu, Mu, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, IM, IP, Simple Western, WB
p53 Antibody (PAb
240) - BSA Free
NB200-103
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow (Intracellular) p53 Antibody (PAb 240) - BSA Free
(3 Reviews)
(43 Publications)
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Erythropoietin/EPO
[HRP]
MEP00B
N/A Erythropoietin/EPO [HRP]
N/A Erythropoietin/EPO [HRP]
(105 Publications)
Species: Mu
Applications: ELISA
Thymidylate
Synthase Antibody (HL ...
NBP3-25721
Western Blot Thymidylate Synthase Antibody (HL1236) - Azide and BSA Free
Western Blot Thymidylate Synthase Antibody (HL1236) - Azide and BSA Free
Immunohistochemistry-Paraffin Thymidylate Synthase Antibody (HL1236) - Azide and BSA Free
Species: Ca, Fe, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
c-jun [p Ser63]
Antibody (1018Y) [Unc ...
MAB8930
Western Blot c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
Immunocytochemistry c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
Simple Western c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
(1 Review)
(3 Publications)
Species: Hu
Applications: ICC, Simple Western, WB
ErbB2/Her2
[Unconjugated]
1129-ER
SDS-PAGE ErbB2/Her2 [Unconjugated]
Bioactivity ErbB2/Her2 [Unconjugated]
(58 Publications)
Species: Hu
Applications: BA
⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Publications for PRL-2/PTP4A2 Antibody (NBP2-93937) (0)

There are no publications for PRL-2/PTP4A2 Antibody (NBP2-93937).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PRL-2/PTP4A2 Antibody (NBP2-93937) (0)

There are no reviews for PRL-2/PTP4A2 Antibody (NBP2-93937). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PRL-2/PTP4A2 Antibody (NBP2-93937) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PRL-2/PTP4A2 Products

Research Areas for PRL-2/PTP4A2 Antibody (NBP2-93937)

Find related products by research area.

Blogs on PRL-2/PTP4A2

There are no specific blogs for PRL-2/PTP4A2, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PRL-2/PTP4A2 Antibody - Azide and BSA Free and receive a gift card or discount.


Bioinformatics

Gene Symbol PTP4A2