![Immunocytochemistry/Immunofluorescence: PRKCBP1 Antibody [NBP1-87227] - Staining of human cell line A-431 shows localization to nucleoplasm & the Golgi apparatus. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/PRKCBP1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-87227-img0010.jpg "Immunocytochemistry/Immunofluorescence: PRKCBP1 Antibody [NBP1-87227] - Staining of human cell line A-431 shows localization to nucleoplasm & the Golgi apparatus. Antibody staining is shown in green.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: TTKTDKTSTTGSILNLNLDRSKAEMDLKELSESVQQQSTPVPLISPKRQIRSRFQLNLDKTIESCKAQLGINEISEDVYTAVEHSDSEDSEKSDSSDSEYISDDEQKSKN |
| Predicted Species | Mouse (92%), Rat (92%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ZMYND8 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for PRKCBP1 Antibody (NBP1-87227)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ZMYND8 |
![Immunohistochemistry-Paraffin: PRKCBP1 Antibody [NBP1-87227] - Staining of human cerebral cortex shows strong positivity in neurons.](http://images.novusbio.com/fullsize/PRKCBP1-Antibody-Immunohistochemistry-Paraffin-NBP1-87227-img0016.jpg "Immunohistochemistry-Paraffin: PRKCBP1 Antibody [NBP1-87227] - Staining of human cerebral cortex shows strong positivity in neurons.")
![Immunohistochemistry-Paraffin: PRKCBP1 Antibody [NBP1-87227] - Staining of human cerebral cortex shows strong cytoplasmic and nuclear positivity in neuronal cells.](http://images.novusbio.com/fullsize/PRKCBP1-Antibody-Immunohistochemistry-Paraffin-NBP1-87227-img0011.jpg "Immunohistochemistry-Paraffin: PRKCBP1 Antibody [NBP1-87227] - Staining of human cerebral cortex shows strong cytoplasmic and nuclear positivity in neuronal cells.")
![Immunohistochemistry-Paraffin: PRKCBP1 Antibody [NBP1-87227] - Staining of human liver shows no positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize/PRKCBP1-Antibody-Immunohistochemistry-Paraffin-NBP1-87227-img0013.jpg "Immunohistochemistry-Paraffin: PRKCBP1 Antibody [NBP1-87227] - Staining of human liver shows no positivity in hepatocytes as expected.")
![Immunohistochemistry-Paraffin: PRKCBP1 Antibody [NBP1-87227] - Staining of human cerebellum shows moderate positivity in cells in molecular layer.](http://images.novusbio.com/fullsize/PRKCBP1-Antibody-Immunohistochemistry-Paraffin-NBP1-87227-img0014.jpg "Immunohistochemistry-Paraffin: PRKCBP1 Antibody [NBP1-87227] - Staining of human cerebellum shows moderate positivity in cells in molecular layer.")
![Immunohistochemistry-Paraffin: PRKCBP1 Antibody [NBP1-87227] - Staining of human fallopian tube shows moderate nuclear positivity in glandular cells.](http://images.novusbio.com/fullsize/PRKCBP1-Antibody-Immunohistochemistry-Paraffin-NBP1-87227-img0015.jpg "Immunohistochemistry-Paraffin: PRKCBP1 Antibody [NBP1-87227] - Staining of human fallopian tube shows moderate nuclear positivity in glandular cells.")
![Bioactivity CTLA-4 [Unconjugated]](https://images.novusbio.com/images2/CTLA4_7268CT_2293.jpg)
![Flow Cytometry EpCAM/TROP1 Antibody [Unconjugated]](https://images.novusbio.com/images2/EpCAM_AF960_Flow_Cytometry_15685.jpg)
![Immunohistochemistry EpCAM/TROP1 Antibody [Unconjugated]](https://images.novusbio.com/images2/EpCAM_AF960_Immunohistochemistry_23512.jpg)
![Immunohistochemistry EpCAM/TROP1 Antibody [Unconjugated]](https://images.novusbio.com/images2/EpCAM_AF960_Immunohistochemistry_23513.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")