![Western Blot: RCOR1/CoREST Antibody (9B3R7) [NBP3-16225] - Analysis of extracts of C2C12 cells, using RCOR1/CoREST Rabbit mAb (NBP3-16225) at 1:500 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit. Exposure time: 3min.](http://images.novusbio.com/fullsize/RCOR1-CoREST-Antibody-9B3R7-Western-Blot-NBP3-16225-img0005.jpg "Western Blot: RCOR1/CoREST Antibody (9B3R7) [NBP3-16225] - Analysis of extracts of C2C12 cells, using RCOR1/CoREST Rabbit mAb (NBP3-16225) at 1:500 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit. Exposure time: 3min.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC, IP, ChIP |
| Clone | 9B3R7 |
| Clonality | Monoclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Additional Information | Recombinant Monoclonal Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human RCOR1/CoREST (Q9UKL0). MPAMVEKGPEVSGKRRGRNNAAASASAAAASAAASAACASPAATAASGAAASSASAAAASAAAAPNNGQNKSLAAAAPNGNSSSNSWEEGSSGSSSDEEH |
| Isotype | IgG |
| Clonality | Monoclonal |
| Host | Rabbit |
| Gene | RCOR1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS, 0.05% BSA, 50% glycerol, pH7.3 |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for RCOR1/CoREST Antibody (NBP3-16225)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | RCOR1 |
![Immunohistochemistry-Paraffin: RCOR1/CoREST Antibody (9B3R7) [NBP3-16225] - Mouse brain using RCOR1/CoREST Rabbit mAb (NBP3-16225) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/RCOR1-CoREST-Antibody-9B3R7-Immunohistochemistry-Paraffin-NBP3-16225-img0003.jpg "Immunohistochemistry-Paraffin: RCOR1/CoREST Antibody (9B3R7) [NBP3-16225] - Mouse brain using RCOR1/CoREST Rabbit mAb (NBP3-16225) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.")
![Chromatin Immunoprecipitation: RCOR1/CoREST Antibody (9B3R7) [NBP3-16225] - Chromatin immunoprecipitation analysis of extracts of HepG2 cells, using RCOR1/CoREST antibody (NBP3-16225) and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.](http://images.novusbio.com/fullsize/RCOR1-CoREST-Antibody-9B3R7-Chromatin-Immunoprecipitation-NBP3-16225-img0007.jpg "Chromatin Immunoprecipitation: RCOR1/CoREST Antibody (9B3R7) [NBP3-16225] - Chromatin immunoprecipitation analysis of extracts of HepG2 cells, using RCOR1/CoREST antibody (NBP3-16225) and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.")
![Western Blot: RCOR1/CoREST Antibody (9B3R7) [NBP3-16225] - Analysis of extracts of various cell lines, using RCOR1/CoREST Rabbit mAb (NBP3-16225) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.](http://images.novusbio.com/fullsize/RCOR1-CoREST-Antibody-9B3R7-Western-Blot-NBP3-16225-img0004.jpg "Western Blot: RCOR1/CoREST Antibody (9B3R7) [NBP3-16225] - Analysis of extracts of various cell lines, using RCOR1/CoREST Rabbit mAb (NBP3-16225) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.")
![Immunohistochemistry-Paraffin: RCOR1/CoREST Antibody (9B3R7) [NBP3-16225] - Rat lung using RCOR1/CoREST Rabbit mAb (NBP3-16225) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/RCOR1-CoREST-Antibody-9B3R7-Immunohistochemistry-Paraffin-NBP3-16225-img0001.jpg "Immunohistochemistry-Paraffin: RCOR1/CoREST Antibody (9B3R7) [NBP3-16225] - Rat lung using RCOR1/CoREST Rabbit mAb (NBP3-16225) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.")
![Immunohistochemistry-Paraffin: RCOR1/CoREST Antibody (9B3R7) [NBP3-16225] - Human appendix using RCOR1/CoREST Rabbit mAb (NBP3-16225) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/RCOR1-CoREST-Antibody-9B3R7-Immunohistochemistry-Paraffin-NBP3-16225-img0002.jpg "Immunohistochemistry-Paraffin: RCOR1/CoREST Antibody (9B3R7) [NBP3-16225] - Human appendix using RCOR1/CoREST Rabbit mAb (NBP3-16225) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.")
![Immunoprecipitation: RCOR1/CoREST Antibody (9B3R7) [NBP3-16225] - Analysis of 300ug extracts of THP-1 cells using 3ug RCOR1/CoREST antibody (NBP3-16225). Western blot was performed from the immunoprecipitate using RCOR1/CoREST antibody (NBP3-16225) at a dilition of 1:1000.](http://images.novusbio.com/fullsize/RCOR1-CoREST-Antibody-9B3R7-Immunoprecipitation-NBP3-16225-img0006.jpg "Immunoprecipitation: RCOR1/CoREST Antibody (9B3R7) [NBP3-16225] - Analysis of 300ug extracts of THP-1 cells using 3ug RCOR1/CoREST antibody (NBP3-16225). Western blot was performed from the immunoprecipitate using RCOR1/CoREST antibody (NBP3-16225) at a dilition of 1:1000.")
![Western Blot G9a/EHMT2 Antibody (A8620A) [Unconjugated]](https://images.novusbio.com/images/pp-a8620a-00_human-mouse-g9a-ehmt2-mab-clone-a8620a-4120241252118.jpg)
![Immunohistochemistry G9a/EHMT2 Antibody (A8620A) [Unconjugated]](https://images.novusbio.com/images/pp-a8620a-00_human-mouse-g9a-ehmt2-mab-clone-a8620a-412024125214.jpg)
![Immunohistochemistry G9a/EHMT2 Antibody (A8620A) [Unconjugated]](https://images.novusbio.com/images/pp-a8620a-00_human-mouse-g9a-ehmt2-mab-clone-a8620a-4120241251265.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")