![Immunocytochemistry/Immunofluorescence: FHOD1 Antibody [NBP1-83900] - Staining of human cell line A-431 shows localization to cytosol. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/FHOD1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-83900-img0004.jpg "Immunocytochemistry/Immunofluorescence: FHOD1 Antibody [NBP1-83900] - Staining of human cell line A-431 shows localization to cytosol. Antibody staining is shown in green.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: AMPNEAGGHPDARQLWDSPETAPAARTPQSPAPCVLLRAQRSLAPEPKEPLIPASPKAEPIWELPTRAPRLSIGDLDFSDLGEDEDQDMLNVESVEAGKDIPAPSPPLPLLSGVP |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | FHOD1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. Use in WB reported in scientific literature ( PMID 24062339). |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for FHOD1 Antibody (NBP1-83900)Find related products by research area.
|
|
CD19: An Undoubted Biomarker for B Cells CD19 is a cell surface protein member of the large immunoglobulin superfamily that complexes with CD21, CD81, and CD225 in the membrane of mature B-cells. A major function of CD19 is to assemble with the antigen receptor of B-lymphocytes to decrease t... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | FHOD1 |
![Immunohistochemistry-Paraffin: FHOD1 Antibody [NBP1-83900] - Staining of human lymph node shows strong cytoplasmic positivity in germinal center cells.](http://images.novusbio.com/fullsize/FHOD1-Antibody-Immunohistochemistry-Paraffin-NBP1-83900-img0008.jpg "Immunohistochemistry-Paraffin: FHOD1 Antibody [NBP1-83900] - Staining of human lymph node shows strong cytoplasmic positivity in germinal center cells.")
![Immunohistochemistry-Paraffin: FHOD1 Antibody [NBP1-83900] - Staining of human cerebellum shows no cytoplasmic positivity in Purkinje cells as expected.](http://images.novusbio.com/fullsize/FHOD1-Antibody-Immunohistochemistry-Paraffin-NBP1-83900-img0005.jpg "Immunohistochemistry-Paraffin: FHOD1 Antibody [NBP1-83900] - Staining of human cerebellum shows no cytoplasmic positivity in Purkinje cells as expected.")
![Immunohistochemistry-Paraffin: FHOD1 Antibody [NBP1-83900] - Staining of human gastrointestinal shows strong cytoplasmic positivity in lymphoid cells.](http://images.novusbio.com/fullsize/FHOD1-Antibody-Immunohistochemistry-Paraffin-NBP1-83900-img0006.jpg "Immunohistochemistry-Paraffin: FHOD1 Antibody [NBP1-83900] - Staining of human gastrointestinal shows strong cytoplasmic positivity in lymphoid cells.")
![Immunohistochemistry-Paraffin: FHOD1 Antibody [NBP1-83900] - Staining of human liver shows no cytoplasmic positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize/FHOD1-Antibody-Immunohistochemistry-Paraffin-NBP1-83900-img0007.jpg "Immunohistochemistry-Paraffin: FHOD1 Antibody [NBP1-83900] - Staining of human liver shows no cytoplasmic positivity in hepatocytes as expected.")
![Immunohistochemistry Complement Factor H Antibody [Unconjugated]](https://images.novusbio.com/images2/Complement_Factor_H_AF4779_Immunohistochemistry_7182.jpg)
![Immunohistochemistry LDLR Antibody [Unconjugated]](https://images.novusbio.com/images2/LDL_R_AF2255_Immunohistochemistry_7149.jpg)
![Western Blot LDLR Antibody [Unconjugated]](https://images.novusbio.com/images2/LDLR_AF2255_Western_Blot_23731.jpg)
![Western Blot LDLR Antibody [Unconjugated]](https://images.novusbio.com/images/af2255_mouse-ldl-r-affinity-purified-polyclonal-ab-4120241049445.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")