PPP2CB Antibody - Azide and BSA Free Summary
Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 1-309 of human PPP2CB (NP_001009552.1). MDDKAFTKELDQWVEQLNECKQLNENQVRTLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYPERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
PPP2CB |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunocytochemistry/ Immunofluorescence 1:50-1:200
- Immunohistochemistry 1:100-1:200
- Immunohistochemistry-Paraffin
- Western Blot 1:500-1:2000
|
Theoretical MW |
35 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.3), 50% glycerol |
Preservative |
0.09% Sodium Azide |
Purity |
Affinity purified |
Alternate Names for PPP2CB Antibody - Azide and BSA Free
Background
PPP2CB also known as Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform, is a 309 amino acid protein that is 36 kDa, localizes in cytoplasm and nucleus, is implicated in the negative control of cell growth and division and modulates the activity of phosphorylase B kinase casein kinase 2, mitogen-stimulated S6 kinase, and MAP-2 kinase. Studies of this protein are being done on the following diseases and disorders: cerebral cavernous malformations, cavernous malformation, cerebral cavernous malformations 3, Werner syndrome, Chagas disease, hepatitis c, trypanosomiasis, cerebritis, Alzheimer's disease, prostate cancer, hepatitis, prostatitis, immunodeficiency, malaria, neuronitis, and breast cancer. PPP2CB protein has been linked to Neurophysiological process Glutamate regulation of Dopamine D1A receptor signaling, Signal transduction Calcium signaling, Development Beta-adrenergic receptors signaling via cAMP,Cell cycle Regulation of G1/S transition (part 1), Cell cycle Start of DNA replication in early S phase, Cell Cycle Control by BTG Proteins, CDK5 Pathway, mTOR Pathway, AMPK Enzyme Complex Pathway, Cyclins and Cell Cycle Regulation, Akt Pathway, Insulin Pathway, TGF-beta Pathway, Wnt Pathway, Apoptosis and survival BAD phosphorylation, and many other pathways where interacts with HIST1H4B , HIST1H4A, HIST1H4C, HIST1H4D, HIST1H4E, AXIN2, and over 280 other interacting proteins.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
Species: Ch, Fe, Ha, Hu, Mu, Pl, Po, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KO, WB
Species: Hu
Applications: ICC, IHC, Simple Western, WB
Species: Hu, Mu
Applications: IHC, IHC-P, IP (-), WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov
Publications for PPP2CB Antibody (NBP2-94074) (0)
There are no publications for PPP2CB Antibody (NBP2-94074).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for PPP2CB Antibody (NBP2-94074) (0)
There are no reviews for PPP2CB Antibody (NBP2-94074).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for PPP2CB Antibody (NBP2-94074) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional PPP2CB Products
Research Areas for PPP2CB Antibody (NBP2-94074)
Find related products by research area.
|
Blogs on PPP2CB