![Immunohistochemistry-Paraffin: PMCA3 Antibody [NBP1-87259] - Analysis in human cerebral cortex and skeletal muscle tissues using NBP1-87259 antibody. Corresponding PMCA3 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/PMCA3-Antibody-Immunohistochemistry-Paraffin-NBP1-87259-img0016.jpg "Immunohistochemistry-Paraffin: PMCA3 Antibody [NBP1-87259] - Analysis in human cerebral cortex and skeletal muscle tissues using NBP1-87259 antibody. Corresponding PMCA3 RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: IRVVKAFRSSLYEGLEKPESKTSIHNFMATPEFLINDYTHNIPLIDDTDVDENEERLRAPPPPSPNQNNNAIDSGIYLTTHVTKSATSSVFSSSPGSPLHSVETS |
| Predicted Species | Mouse (93%), Rat (93%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ATP2B3 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP1-87259 | Applications | Species |
|---|---|---|
| Beuschlein F, Boulkroun S, Osswald A et al. Somatic mutations in ATP1A1 and ATP2B3 lead to aldosterone-producing adenomas and secondary hypertension. Nat Genet 2013-04-01 [PMID: 23416519] |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ATP2B3 |
![Immunocytochemistry/Immunofluorescence: PMCA3 Antibody [NBP1-87259] - Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane & the Golgi apparatus.](http://images.novusbio.com/fullsize/PMCA3-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-87259-img0007.jpg "Immunocytochemistry/Immunofluorescence: PMCA3 Antibody [NBP1-87259] - Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane & the Golgi apparatus.")
![Immunohistochemistry-Paraffin: PMCA3 Antibody [NBP1-87259] - Staining of human cerebellum shows strong positivity in neuronal processes.](http://images.novusbio.com/fullsize/PMCA3-Antibody-Immunohistochemistry-Paraffin-NBP1-87259-img0012.jpg "Immunohistochemistry-Paraffin: PMCA3 Antibody [NBP1-87259] - Staining of human cerebellum shows strong positivity in neuronal processes.")
![Immunohistochemistry-Paraffin: PMCA3 Antibody [NBP1-87259] - Staining of human lymph node shows no positivity in non-germinal center cells as expected.](http://images.novusbio.com/fullsize/PMCA3-Antibody-Immunohistochemistry-Paraffin-NBP1-87259-img0013.jpg "Immunohistochemistry-Paraffin: PMCA3 Antibody [NBP1-87259] - Staining of human lymph node shows no positivity in non-germinal center cells as expected.")
![Immunohistochemistry-Paraffin: PMCA3 Antibody [NBP1-87259] - Staining of human cerebral cortex shows moderate to strong positivity in neuronal processes.](http://images.novusbio.com/fullsize/PMCA3-Antibody-Immunohistochemistry-Paraffin-NBP1-87259-img0015.jpg "Immunohistochemistry-Paraffin: PMCA3 Antibody [NBP1-87259] - Staining of human cerebral cortex shows moderate to strong positivity in neuronal processes.")
![Immunohistochemistry-Paraffin: PMCA3 Antibody [NBP1-87259] - Staining of human skeletal muscle shows no positivity in myocytes as expected.](http://images.novusbio.com/fullsize/PMCA3-Antibody-Immunohistochemistry-Paraffin-NBP1-87259-img0014.jpg "Immunohistochemistry-Paraffin: PMCA3 Antibody [NBP1-87259] - Staining of human skeletal muscle shows no positivity in myocytes as expected.")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")