Plexin A3 Antibody Summary
Immunogen |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SSLDAGSRVTVTVRDSECQFVRRDAKAIVCISPLSTLGPSQAPITLAIDRANISSPGLIYTYTQDPTVTRLEPTWSIINGSTA |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
PLXNA3 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
- Western Blot 0.04-0.4 ug/ml
|
Application Notes |
ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100. |
Control Peptide |
|
Reactivity Notes
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Affinity purified |
Alternate Names for Plexin A3 Antibody
Background
Plexin A3, also known by its gene name PLXNA3, has 1,871 amino acids and is approximately 208kDa. Plexin A3 is a cell surface, transmembrane protein that is a member of the Plexin family. Plexin A3 is thought to play a role in the development of neural tissue and epithelial tissue, as well as function in axon guidance. Current research on Plexin A3 is being performed in relation to several diseases and disorders including Rett syndrome, neuronitis and ovarian cancer. Plexin A3 has also been shown to have interactions with SMN1, SMN2, MAPK8IP2, CBFA2T3 and CSNK2B in pathways such as the axon guidance pathway and the Semaphorin signaling pathway.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: BA, BA
Species: Hu, Mu
Applications: ICC, IHC, WB
Species: Mu, Rt
Applications: Block, CyTOF-ready, Flow, IHC, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Mu, Rt
Applications: Block, IHC, Simple Western, WB
Species: Mu
Applications: BA
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC, Simple Western, WB
Species: Hu
Applications: IHC, WB
Species: Bv, Ca, Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Mu
Applications: IHC, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Mu
Applications: CyTOF-ready, Flow, IHC, WB
Species: Mu
Applications: CyTOF-ready, Flow, IHC, WB
Species: Mu
Applications: IHC, WB
Species: Ca, Hu, Mu, Po, Rt
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB, ICC/IF
Publications for Plexin A3 Antibody (NBP2-56699) (0)
There are no publications for Plexin A3 Antibody (NBP2-56699).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Plexin A3 Antibody (NBP2-56699) (0)
There are no reviews for Plexin A3 Antibody (NBP2-56699).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Plexin A3 Antibody (NBP2-56699) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Plexin A3 Products
Research Areas for Plexin A3 Antibody (NBP2-56699)
Find related products by research area.
|
Blogs on Plexin A3