PLEC1 Antibody Summary
Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: MGISPLGNQSVIIETGRAHPDSRRAVFHFHYEVDRRMSDTFCTLSENLILDDCGNCVPLPGGEEKQKKNYVAYTCKLMELAKNCDNKNEQLQCDHCDTLNDKYFCFEGSCEKVDMVYSGDSFCRKDFTDSQAAKT |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
PLCE1 |
Purity |
Immunogen affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin 1:50 - 1:200
|
Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Control Peptide |
|
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Immunogen affinity purified |
Alternate Names for PLEC1 Antibody
Background
The PLEC1 gene (also known as the PLEC gene) encodes a plectin protein that exists in nine isoforms: isoform 1 is 4,684 amino acids long at 531 kDA; isoform 2 is 4,574 amino acids long at 518 kDA; isoform 3 is 4,570 amino acids long at 518 kDA; isoform 4 is 4,547 amino acids long at 516 kDA; isoform 5 is 4,547 amino acids long at 516 kDA; isoform 6 is 4,551 amino acids long at 516 kDA; isoform 7 is 4,515 amino acids long at 512 kDA; isoform 8 is 4,525 amino acids long at 513 kDA; and isoform 9 is 4,533 amino acids long at 514 kDA. The PLEC1 gene functions as a structural component of muscle as links intermediate filaments with microtubules and microfilaments. It anchors the intermediate filaments to desmosomes or hemidesmosomes. Additionally, it is thought to have the ability to bind muscle proteins, like actin, to membrane complexes in the muscle. PLEC1 participates in cytoskeletal signaling, cytoskeleton remodeling of neurofilaments and keratin filaments, EGFR1 signaling pathways, apoptosis, collagen formation, and Alpha6-Beta4 integrin signaling pathways. It is known to interact with genes SRRM2, SQSTM1, GRB2, ITGB4, and RANBP2. Defects in this gene lead to epidermolysis bullosa simplex with pyloric atresia (EBS-PA), epidermolysis bullosa simplex with muscular dystrophy (MD-EBS), epidermolysis bullosa simplex Ogna type (O-EBS) and limb-girdle muscular dystrophy type 2Q (LGMD2Q). PLEC1 is also associated with myopathy, neuropathy, alexander disease, myasthenic syndrome, squamous cell carcinoma, epithelial ovarian cancer, and muscular dystrophy.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Pm, Rt
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: IHC
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, MI, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
Species: Hu, Pm, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Bv, Hu, Mu
Applications: Flow, ICC/IF, IF, IHC, IHC-Fr, IHC-P
Species: Ch, Hu, Rt
Applications: ICC, IP, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, S-ELISA, WB
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: IHC
Publications for PLEC1 Antibody (NBP1-92275) (0)
There are no publications for PLEC1 Antibody (NBP1-92275).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for PLEC1 Antibody (NBP1-92275) (0)
There are no reviews for PLEC1 Antibody (NBP1-92275).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for PLEC1 Antibody (NBP1-92275) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional PLEC1 Products
Research Areas for PLEC1 Antibody (NBP1-92275)
Find related products by research area.
|
Blogs on PLEC1