![Knockdown Validated: IQGAP1 Antibody (2C5) [H00008826-M01] - IQGAP1 mRNA and protein levels in HO-8910PM-shIQGAP1, HO-8910PM-shRNA negative and un-transfected HO-8910PM cells were determined by RT-PCR and Western blot analysis, respectively. Image collected and cropped by CiteAb from the following publication (jeccr.biomedcentral.com/articles/10.1186/1756-9966-27-77), licensed under a CC-BY license.](http://images.novusbio.com/fullsize/IQGAP1-Antibody-2C5-Knockdown-Validated-H00008826-M01-img0011.jpg "Knockdown Validated: IQGAP1 Antibody (2C5) [H00008826-M01] - IQGAP1 mRNA and protein levels in HO-8910PM-shIQGAP1, HO-8910PM-shRNA negative and un-transfected HO-8910PM cells were determined by RT-PCR and Western blot analysis, respectively. Image collected and cropped by CiteAb from the following publication (jeccr.biomedcentral.com/articles/10.1186/1756-9966-27-77), licensed under a CC-BY license.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA, ICC/IF, IHC, KD |
| Clone | 2C5 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Description | Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen | IQGAP1 (NP_003861, 611 a.a. ~ 710 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. WQSNKDTQEAQKFALGIFAINEAVESGDVGKTLSALRSPDVGLYGVIPECGETYHSDLAEAKKKKLAVGDNNSKWVKHWVKGGYYYYHNLETQEGGWDEP |
| Specificity | IQGAP1 - IQ motif containing GTPase activating protein 1 |
| Isotype | IgG1 Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | IQGAP1 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF, IHC-P and ELISA. Use in Immunohistochemistry reported in scientific literature (PMID: 19706805). |
|
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
![Western Blot beta-Catenin Antibody [Unconjugated]](https://images.novusbio.com/images2/beta-Catenin_AF1329_Western_Blot_5100.jpg)
![Chromatin Immunoprecipitation (ChIP) beta-Catenin Antibody [Unconjugated]](https://images.novusbio.com/images2/beta-Catenin_AF1329_Chromatin_Immunoprecipitation_11251.jpg)
![Simple Western beta-Catenin Antibody [Unconjugated]](https://images.novusbio.com/images2/betaCatenin_AF1329_Simple_Western_17134.jpg)
![Immunocytochemistry E-Cadherin Antibody [Unconjugated]](https://images.novusbio.com/images2/ECadherin_AF748_Immunocytochemistry_15885.jpg)
![Immunohistochemistry E-Cadherin Antibody [Unconjugated]](https://images.novusbio.com/images2/ECadherin_AF748_Immunohistochemistry_15886.jpg)
![Immunocytochemistry E-Cadherin Antibody [Unconjugated]](https://images.novusbio.com/images2/ECadherin_AF748_Immunocytochemistry_16572.jpg)
![Immunohistochemistry ACE/CD143 Antibody [Unconjugated]](https://images.novusbio.com/images2/ACE_AF1513_Immunohistochemistry_6703.jpg)
![Western Blot ACE/CD143 Antibody [Unconjugated]](https://images.novusbio.com/images2/ACE_AF1513_Flow_Cytometry_20028.jpg)
![Simple Western ACE/CD143 Antibody [Unconjugated]](https://images.novusbio.com/images2/ACE_AF1513_Simple_Western_20109.jpg)
![Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Western_Blot_5930.jpg)
![Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/16332.jpg)
![Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Flow_Cytometry_8283.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for IQGAP1 Antibody (H00008826-M01)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Western Blot: IQGAP1 Antibody (2C5) [H00008826-M01] - Western blot analysis for IQGAP1 in whole-cell lysates from the indicated cell lines. Image collected and cropped by CiteAb from the following publication (jeccr.biomedcentral.com/articles/10.1186/1756-9966-27-77), licensed under a CC-BY license.](http://images.novusbio.com/fullsize/IQGAP1-Antibody-2C5-Western-Blot-H00008826-M01-img0012.jpg "Western Blot: IQGAP1 Antibody (2C5) [H00008826-M01] - Western blot analysis for IQGAP1 in whole-cell lysates from the indicated cell lines. Image collected and cropped by CiteAb from the following publication (jeccr.biomedcentral.com/articles/10.1186/1756-9966-27-77), licensed under a CC-BY license.")
![Immunocytochemistry/Immunofluorescence: IQGAP1 Antibody (2C5) [H00008826-M01] - Analysis of monoclonal antibody to IQGAP1 on HeLa cell. Antibody concentration 10 ug/ml.](http://images.novusbio.com/fullsize/IQGAP1-Antibody-2C5-Immunocytochemistry-Immunofluorescence-H00008826-M01-img0006.jpg "Immunocytochemistry/Immunofluorescence: IQGAP1 Antibody (2C5) [H00008826-M01] - Analysis of monoclonal antibody to IQGAP1 on HeLa cell. Antibody concentration 10 ug/ml.")
![Immunohistochemistry-Paraffin: IQGAP1 Antibody (2C5) [H00008826-M01] - Analysis of monoclonal antibody to IQGAP1 on formalin-fixed paraffin-embedded human salivary gland. Antibody concentration 1 ug/ml.](http://images.novusbio.com/fullsize/IQGAP1-Antibody-2C5-Immunohistochemistry-Paraffin-H00008826-M01-img0008.jpg "Immunohistochemistry-Paraffin: IQGAP1 Antibody (2C5) [H00008826-M01] - Analysis of monoclonal antibody to IQGAP1 on formalin-fixed paraffin-embedded human salivary gland. Antibody concentration 1 ug/ml.")
![Western Blot: IQGAP1 Antibody (2C5) [H00008826-M01] - IQGAP1 monoclonal antibody (M01), clone 2C5 Analysis of IQGAP1 expression in C32.](http://images.novusbio.com/fullsize/IQGAP1-Antibody-2C5-Western-Blot-H00008826-M01-img0010.jpg "Western Blot: IQGAP1 Antibody (2C5) [H00008826-M01] - IQGAP1 monoclonal antibody (M01), clone 2C5 Analysis of IQGAP1 expression in C32.")
![Sandwich ELISA: IQGAP1 Antibody (2C5) [H00008826-M01] - Detection limit for recombinant GST tagged IQGAP1 is approximately 3ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/IQGAP1-Antibody-2C5-Sandwich-ELISA-H00008826-M01-img0009.jpg "Sandwich ELISA: IQGAP1 Antibody (2C5) [H00008826-M01] - Detection limit for recombinant GST tagged IQGAP1 is approximately 3ng/ml as a capture antibody.")
![N/A Angiogenin [HRP]](https://images.novusbio.com/images2/Angiogenin_DAN00_ELISA_28.jpg)
![N/A Angiogenin [HRP]](https://images.novusbio.com/images2/DATA_Angiogenin_DAN00_ELISA_571.jpg)
![Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.](https://images.novusbio.com/images/Mouse-IgG1-Kappa-Light-Chain-Isotype-Control-P3-6-2-8-1-Flow-Cytometry-NBP1-43319-img0002.jpg "Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.")