Home » PKA C alpha » PKA C alpha Proteins » PKA C alpha Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

PKA C alpha Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for PKA C alpha Recombinant Protein Antigen (NBP2-57042PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals offers 100% Guarantee

PKA C alpha Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PKA C alpha.

Source: E. coli

Amino Acid Sequence: KQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PRKACA
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57042.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PKA C alpha Recombinant Protein Antigen

  • cAMP-dependent protein kinase catalytic subunit alpha
  • Cs
  • EC 2.7.11
  • EC 2.7.11.11
  • MGC102831
  • MGC48865
  • PKA C alpha
  • PKA C-alpha
  • Pkaca
  • PKCA1
  • PKCD
  • PRKACA
  • protein kinase A catalytic subunit
  • protein kinase, cAMP-dependent, catalytic, alpha

Background

PKA (Protein Kinase A), also known as cAMP-dependent protein kinase, phosphorylates serine or threonine residues in target protein in response to elevated levels of cAMP. Inactive PKA exists as a tetrameric protein composed of two regulatory (R) subunits and two catalytic (C) subunits. Activation occurs when two cAMP molecules bind to each R subunit which causes a conformational change that releases the active C subunits.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

PKA C beta
Antibody - BSA Free
NBP1-55008
Western Blot PKA C beta Antibody - BSA Free
Western Blot PKA C beta Antibody - BSA Free
(1 Review)
Species: Hu, Mu
Applications: WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(822 Publications)
Species: Hu
Applications: BA
EGF [Unconjugated]
236-EG
SDS-PAGE EGF [Unconjugated]
Bioactivity EGF [Unconjugated]
Cell Culture EGF [Unconjugated]
(864 Publications)
Species: Hu
Applications: BA
CFTR Antibody
(24-1) [Unconjugated] ...
MAB25031
Immunohistochemistry CFTR Antibody (24-1) [Unconjugated] - C-terminus
Immunohistochemistry CFTR Antibody (24-1) [Unconjugated] - C-terminus
Immunoprecipitation CFTR Antibody (24-1) [Unconjugated] - C-terminus
(10 Reviews)
(76 Publications)
Species: Hu
Applications: IHC, IP, WB
AKT [p Ser473]
Antibody [Unconjugate ...
AF887
Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
(50 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NFkB p105/p50
Antibody (2J10D7) - B ...
NB100-56583
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
(1 Review)
(5 Publications)
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, Simple Western, WB
EGFR Antibody
[Unconjugated]
AF231
Immunohistochemistry EGFR Antibody [Unconjugated]
Immunocytochemistry EGFR Antibody [Unconjugated]
Western Blot EGFR Antibody [Unconjugated]
(30 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
GR/NR3C1 Antibody
(BuGR2) - BSA Free
NB300-731
Flow Cytometry GR/NR3C1 Antibody (BuGR2) - BSA Free
Flow Cytometry GR/NR3C1 Antibody (BuGR2) - BSA Free
Immunocytochemistry/ Immunofluorescence GR/NR3C1 Antibody (BuGR2) - BSA Free
(3 Reviews)
(12 Publications)
Species: Gp, Hu, Mu, Rb, Rt, Sh, Ye
Applications: B/N, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, WB
WNK1 Antibody
[Unconjugated]
AF2849
Western Blot WNK1 Antibody [Unconjugated]
(5 Publications)
Species: Mu, Rt
Applications: WB
ERR gamma/NR3B3
Antibody (H6812) [Unc ...
PP-H6812-00
ERR gamma/NR3B3 Antibody (H6812) [Unconjugated]
(15 Publications)
Species: Hu
Applications: DirELISA, IHC, IP, WB
Protein Kinase A
regulatory subunit I ...
NBP1-47935
Immunohistochemistry-Paraffin Protein Kinase A regulatory subunit I alpha Antibody (OTI6C7)
Western Blot Protein Kinase A regulatory subunit I alpha Antibody (OTI6C7)
Immunohistochemistry-Paraffin Protein Kinase A regulatory subunit I alpha Antibody (OTI6C7)
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
SP17 Antibody
(3G9F3)
NBP3-27160
Flow Cytometry SP17 Antibody (3G9F3)
Western Blot SP17 Antibody (3G9F3)
Immunohistochemistry SP17 Antibody (3G9F3)
Species: Hu
Applications: ELISA, Flow, IHC, IHC-P, WB
CREB [p Ser133]
[Biotin]
DYC2510-2
N/A CREB [p Ser133] [Biotin]
N/A CREB [p Ser133] [Biotin]
N/A CREB [p Ser133] [Biotin]
(9 Publications)
Species: Hu, Mu, Rt
Applications: ELISA

SF-1/NR5A1/Steroidogen ...
NBP1-52823
Immunohistochemistry-Paraffin SF-1/NR5A1/Steroidogenic Factor 1 Antibody - BSA Free
Western Blot SF-1/NR5A1/Steroidogenic Factor 1 Antibody - BSA Free
(4 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Phospholamban
Antibody - BSA Free
NBP2-19807
Western Blot Phospholamban Antibody - BSA Free
Immunohistochemistry-Paraffin Phospholamban Antibody - BSA Free
(3 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Human, Mouse, Rat
RelA/NFkB p65 ELISA K ...
NBP2-29661
ELISA Human, Mouse, Rat RelA/NFkB p65 ELISA Kit (Colorimetric)
ELISA Human, Mouse, Rat RelA/NFkB p65 ELISA Kit (Colorimetric)
ELISA Human, Mouse, Rat RelA/NFkB p65 ELISA Kit (Colorimetric)
(95 Publications)
Species: Hu, Mu, Rt
Applications: ELISA
GRASP65 Antibody
(OTI5G8)
NBP2-02665
Immunocytochemistry/ Immunofluorescence GRASP65 Antibody (OTI5G8)
Immunocytochemistry/ Immunofluorescence GRASP65 Antibody (OTI5G8)
Flow Cytometry GRASP65 Antibody (OTI5G8)
(3 Reviews)
(2 Publications)
Species: Ca, Hu, Pm, Po, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
AKAP95/AKAP8
Antibody (3D4) - Azid ...
H00010270-M01
Immunocytochemistry/ Immunofluorescence AKAP95/AKAP8 Antibody (3D4) - Azide and BSA Free
Immunohistochemistry-Paraffin AKAP95/AKAP8 Antibody (3D4) - Azide and BSA Free
Immunoprecipitation AKAP95/AKAP8 Antibody (3D4) - Azide and BSA Free
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA, WB

Publications for PKA C alpha Recombinant Protein Antigen (NBP2-57042PEP) (0)

There are no publications for PKA C alpha Recombinant Protein Antigen (NBP2-57042PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PKA C alpha Recombinant Protein Antigen (NBP2-57042PEP) (0)

There are no reviews for PKA C alpha Recombinant Protein Antigen (NBP2-57042PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PKA C alpha Recombinant Protein Antigen (NBP2-57042PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PKA C alpha Products

Research Areas for PKA C alpha Recombinant Protein Antigen (NBP2-57042PEP)

Find related products by research area.

Blogs on PKA C alpha

There are no specific blogs for PKA C alpha, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PKA C alpha Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol PRKACA