![Western Blot: PIGT Antibody [NBP1-69585] - This Anti-PIGT antibody was used in Western Blot of 721_B tissue lysate at a concentration of 1ug/ml.](http://images.novusbio.com/fullsize/PIGT-Antibody-Western-Blot-NBP1-69585-img0001.jpg "Western Blot: PIGT Antibody [NBP1-69585] - This Anti-PIGT antibody was used in Western Blot of 721_B tissue lysate at a concentration of 1ug/ml.")
| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Concentration | 0.5 mg/ml |
| Description | The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution. |
| Immunogen | Synthetic peptides corresponding to PIGT(phosphatidylinositol glycan anchor biosynthesis, class T) The peptide sequence was selected from the N terminal of PIGT.
Peptide sequence PLPSGDVAATFQFRTRWDSELQREGVSHYRLFPKALGQLISKYSLRELHL. The peptide sequence for this immunogen was taken from within the described region. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | PIGT |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Theoretical MW | 64 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 0.5 mg/ml |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Western Blot: PIGT Antibody [NBP1-69585] - Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1 : 62500 Positive control: 721_B cell lysate PIGT is supported by BioGPS gene expression data to be expressed in 721_B.](http://images.novusbio.com/fullsize/PIGT-Antibody-Western-Blot-NBP1-69585-img0002.jpg "Western Blot: PIGT Antibody [NBP1-69585] - Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1 : 62500 Positive control: 721_B cell lysate PIGT is supported by BioGPS gene expression data to be expressed in 721_B.")
![N/A BDNF [HRP]](https://images.novusbio.com/images2/DATA_BDNF_DBD00_ELISA_587.jpg)
![N/A BDNF [HRP]](https://images.novusbio.com/images2/DATA_BDNF_DBD00_ELISA_588.jpg)
![N/A BDNF [HRP]](https://images.novusbio.com/images2/BDNF_DBD00_ELISA_36.jpg)
![SDS-PAGE beta-NGF [Unconjugated]](https://images.novusbio.com/images2/beta-NGF_256-GF_321.jpg)
![Bioactivity beta-NGF [Unconjugated]](https://images.novusbio.com/images2/beta-NGF_256-GF_322.jpg)
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Western Blot Carbonic Anhydrase III/CA3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Carbonic_Anhydrase_III_AF2185_Western_Blot_20454.jpg)
![Bioactivity GDNF [Unconjugated]](https://images.novusbio.com/images2/GDNF_212GD_2846.jpg)
![SDS-PAGE GDNF [Unconjugated]](https://images.novusbio.com/images2/GDNF_212-GD_62.jpg)
![SEC-MALS GDNF [Unconjugated]](https://images.novusbio.com/images/212-gd_recombinant-human-gdnf-protein-sec-mals-25202393740..jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")