![Immunohistochemistry-Paraffin: MRG-binding protein Antibody [NBP1-84936] - Analysis in human testis and liver tissues using NBP1-84936 antibody. Corresponding MRGBP RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/MRG-binding-protein-Antibody-Immunohistochemistry-Paraffin-NBP1-84936-img0016.jpg "Immunohistochemistry-Paraffin: MRG-binding protein Antibody [NBP1-84936] - Analysis in human testis and liver tissues using NBP1-84936 antibody. Corresponding MRGBP RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LFHAMLGHKPVGVNRHFHMICIRDKFSQNIGRQVPSKVIWDHLSTMYDMQALHESEILPFPNPERNFVLPEEIIQEVREGKVMIEEEMKEEMKEDVDPHNGADDVFSSSGSLGKASEKSSKDKEKNSSDLGCKE |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | MRGBP |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for MRG-binding protein Antibody (NBP1-84936)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | MRGBP |
![Western Blot: MRG-binding protein Antibody [NBP1-84936] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-352](http://images.novusbio.com/fullsize/MRG-binding-protein-Antibody-Western-Blot-NBP1-84936-img0006.jpg "Western Blot: MRG-binding protein Antibody [NBP1-84936] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-352")
![Immunocytochemistry/Immunofluorescence: MRG-binding protein Antibody [NBP1-84936] - Staining of human cell line U-2 OS shows localization to nucleus.](http://images.novusbio.com/fullsize/MRG-binding-protein-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-84936-img0015.jpg "Immunocytochemistry/Immunofluorescence: MRG-binding protein Antibody [NBP1-84936] - Staining of human cell line U-2 OS shows localization to nucleus.")
![Immunohistochemistry-Paraffin: MRG-binding protein Antibody [NBP1-84936] - Staining of human Skeletal muscle shows very weak nuclear positivity in myocytes.](http://images.novusbio.com/fullsize/MRG-binding-protein-Antibody-Immunohistochemistry-Paraffin-NBP1-84936-img0019.jpg "Immunohistochemistry-Paraffin: MRG-binding protein Antibody [NBP1-84936] - Staining of human Skeletal muscle shows very weak nuclear positivity in myocytes.")
![Western Blot: MRG-binding protein Antibody [NBP1-84936] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).](http://images.novusbio.com/fullsize/MRG-binding-protein-Antibody-Western-Blot-NBP1-84936-img0004.jpg "Western Blot: MRG-binding protein Antibody [NBP1-84936] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).")
![Immunohistochemistry-Paraffin: MRG-binding protein Antibody [NBP1-84936] - Staining of human Liver shows very weak nuclear positivity in hepatocytes.](http://images.novusbio.com/fullsize/MRG-binding-protein-Antibody-Immunohistochemistry-Paraffin-NBP1-84936-img0017.jpg "Immunohistochemistry-Paraffin: MRG-binding protein Antibody [NBP1-84936] - Staining of human Liver shows very weak nuclear positivity in hepatocytes.")
![Immunohistochemistry-Paraffin: MRG-binding protein Antibody [NBP1-84936] - Staining of human Pancreas shows very weak nuclear positivity in exocrine glandular cells.](http://images.novusbio.com/fullsize/MRG-binding-protein-Antibody-Immunohistochemistry-Paraffin-NBP1-84936-img0018.jpg "Immunohistochemistry-Paraffin: MRG-binding protein Antibody [NBP1-84936] - Staining of human Pancreas shows very weak nuclear positivity in exocrine glandular cells.")
![Immunohistochemistry-Paraffin: MRG-binding protein Antibody [NBP1-84936] - Staining of human Testis shows strong nuclear positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/MRG-binding-protein-Antibody-Immunohistochemistry-Paraffin-NBP1-84936-img0020.jpg "Immunohistochemistry-Paraffin: MRG-binding protein Antibody [NBP1-84936] - Staining of human Testis shows strong nuclear positivity in cells in seminiferous ducts.")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")