Novus Biologicals products are now on bio-techne.com

PIASy Recombinant Protein Antigen

Images

 
There are currently no images for PIASy Recombinant Protein Antigen (NBP3-17791PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

PIASy Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PIASy

Source: E. coli

Amino Acid Sequence: PYDQLIIDGLLSKILSECEDADEIEYLVDGSWCPIRAEKERSCSPQGAILVLGPSDANGLLPAPSVNGSGA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PIAS4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-17791.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PIASy Recombinant Protein Antigen

  • E3 SUMO-protein ligase PIAS4
  • FLJ12419
  • MGC35296
  • Piasg
  • PIAS-gamma
  • PIASY
  • Protein inhibitor of activated STAT protein 4
  • Protein inhibitor of activated STAT protein gamma
  • protein inhibitor of activated STAT protein PIASy
  • protein inhibitor of activated STAT, 4
  • zinc finger, MIZ-type containing 6
  • ZMIZ6

Background

The IL-6-type family of cytokines, which includes IL-6 as well as a number of similar cytokines and growth factors, plays a significant role in regulating gene activation, proliferation and differentiation. Transcription factors of the Stat family are known to be involved in this signal transduction pathway, undergoing phosphorylation, dimerization and translocation to the nucleus upon activation. PIAS 1, for protein inhibitor of activated Stat1 (also designated Gu/RNA helicase II binding protein), binds specifically to Stat1, blocking Stat1 DNA-binding activity and inhibiting Stat1-mediated gene activation. PIAS 1 also binds to the Gu/RNA helicase II enzyme, leading to the proteolytic cleavage of Gu/RH-II. PIAS 3 similarly binds specifically to Stat3, blocking Stat3 DNA-binding activity and inhibiting Stat3-mediated gene activation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89150
Species: Hu, Rt
Applications: IHC, IHC-P, WB
H00011026-M01
Species: Hu
Applications: ELISA, WB
NBP2-01109
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
AF2959
Species: Hu, Mu
Applications: WB
NBP3-16858
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP3-15676
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
E2-645
Species: Hu
Applications: EnzAct
NBP1-77160
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP3-16540
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-77159
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
NB400-141
Species: Ha, Hu, Mu
Applications: ICC/IF, IP, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
H00022954-M09
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, KD, WB
NB100-59787
Species: Hu, Mu
Applications: Flow, IB, ICC/IF, IHC, IHC-P, IP, KD, PLA, WB
NB100-56479
Species: Bv, Ca, Hu, Mu, Po, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB100-56603
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
NBP2-26504
Species: Hu, Mu, Rt
Applications: B/N, Func-Inh, In vitro, In vivo
NBP3-17791PEP
Species: Hu
Applications: AC

Publications for PIASy Recombinant Protein Antigen (NBP3-17791PEP) (0)

There are no publications for PIASy Recombinant Protein Antigen (NBP3-17791PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PIASy Recombinant Protein Antigen (NBP3-17791PEP) (0)

There are no reviews for PIASy Recombinant Protein Antigen (NBP3-17791PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PIASy Recombinant Protein Antigen (NBP3-17791PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PIASy Products

Research Areas for PIASy Recombinant Protein Antigen (NBP3-17791PEP)

Find related products by research area.

Blogs on PIASy

There are no specific blogs for PIASy, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

PIASy Antibody
NB600-1318

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PIASy Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PIAS4