![Western Blot: SUMO1 Antibody (6F8B6) [NBP3-15676] - Western blot analysis of extracts of various cell lines, using SUMO1 antibody (NBP3-15676) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.](http://images.novusbio.com/fullsize/SUMO1-Antibody-6F8B6-Western-Blot-NBP3-15676-img0006.jpg "Western Blot: SUMO1 Antibody (6F8B6) [NBP3-15676] - Western blot analysis of extracts of various cell lines, using SUMO1 antibody (NBP3-15676) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clone | 6F8B6 |
| Clonality | Monoclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Additional Information | Recombinant Monoclonal Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-101 of human Sumo 1 (P63165). MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGGHSTV |
| Isotype | IgG |
| Clonality | Monoclonal |
| Host | Rabbit |
| Gene | SUMO1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for SUMO1 Antibody (NBP3-15676)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SUMO1 |
![Western Blot: SUMO1 Antibody (6F8B6) [NBP3-15676] - Western blot analysis of extracts of various cell lines, using SUMO1 antibody (NBP3-15676) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 60s.](http://images.novusbio.com/fullsize/SUMO1-Antibody-6F8B6-Western-Blot-NBP3-15676-img0005.jpg "Western Blot: SUMO1 Antibody (6F8B6) [NBP3-15676] - Western blot analysis of extracts of various cell lines, using SUMO1 antibody (NBP3-15676) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 60s.")
![Western Blot: SUMO1 Antibody (6F8B6) [NBP3-15676] - Western blot analysis of extracts of various cell lines, using SUMO1 antibody (NBP3-15676) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1min.](http://images.novusbio.com/fullsize/SUMO1-Antibody-6F8B6-Western-Blot-NBP3-15676-img0007.jpg "Western Blot: SUMO1 Antibody (6F8B6) [NBP3-15676] - Western blot analysis of extracts of various cell lines, using SUMO1 antibody (NBP3-15676) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1min.")
![Immunocytochemistry/ Immunofluorescence: SUMO1 Antibody (6F8B6) [SUMO1] - Confocal imaging of NIH/3T3 cells using [KO Validated] SUMO1 Rabbit mAb . The cells were counterstained with alpha-Tubulin Mouse mAb (Green). DAPI was used for nuclear staining (blue). Objective: 100x.](http://images.novusbio.com/fullsize/nbp3-15676_rabbit-sumo1-mab-6f8b6-5220251733572.jpg "Immunocytochemistry/ Immunofluorescence: SUMO1 Antibody (6F8B6) [SUMO1] - Confocal imaging of NIH/3T3 cells using [KO Validated] SUMO1 Rabbit mAb . The cells were counterstained with alpha-Tubulin Mouse mAb (Green). DAPI was used for nuclear staining (blue). Objective: 100x.")
![Immunohistochemistry: SUMO1 Antibody (6F8B6) [SUMO1] - Immunohistochemistry analysis of paraffin-embedded Mouse brain tissue using [KO Validated] SUMO1 Rabbit mAb at a dilution of 1:5000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-15676_rabbit-sumo1-mab-6f8b6-5220251734543.jpg "Immunohistochemistry: SUMO1 Antibody (6F8B6) [SUMO1] - Immunohistochemistry analysis of paraffin-embedded Mouse brain tissue using [KO Validated] SUMO1 Rabbit mAb at a dilution of 1:5000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.")
![Immunohistochemistry: SUMO1 Antibody (6F8B6) [SUMO1] - Immunohistochemistry analysis of paraffin-embedded Rat spleen tissue using [KO Validated] SUMO1 Rabbit mAb at a dilution of 1:5000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-15676_rabbit-sumo1-mab-6f8b6-5220251734513.jpg "Immunohistochemistry: SUMO1 Antibody (6F8B6) [SUMO1] - Immunohistochemistry analysis of paraffin-embedded Rat spleen tissue using [KO Validated] SUMO1 Rabbit mAb at a dilution of 1:5000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.")
![Immunohistochemistry: SUMO1 Antibody (6F8B6) [SUMO1] - Immunohistochemistry analysis of paraffin-embedded Human esophagus tissue using [KO Validated] SUMO1 Rabbit mAb at a dilution of 1:5000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-15676_rabbit-sumo1-mab-6f8b6-52202517315566.jpg "Immunohistochemistry: SUMO1 Antibody (6F8B6) [SUMO1] - Immunohistochemistry analysis of paraffin-embedded Human esophagus tissue using [KO Validated] SUMO1 Rabbit mAb at a dilution of 1:5000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.")
![Immunohistochemistry: SUMO1 Antibody (6F8B6) [SUMO1] - Immunohistochemistry analysis of paraffin-embedded Human tonsil tissue using [KO Validated] SUMO1 Rabbit mAb at a dilution of 1:5000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-15676_rabbit-sumo1-mab-6f8b6-5220251733570.jpg "Immunohistochemistry: SUMO1 Antibody (6F8B6) [SUMO1] - Immunohistochemistry analysis of paraffin-embedded Human tonsil tissue using [KO Validated] SUMO1 Rabbit mAb at a dilution of 1:5000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.")
![Western Blot: SUMO1 Antibody (6F8B6) [SUMO1] - Western blot analysis of lysates from wild type(WT) and SUMO1 knockout (KO) 293T cells, using [KO Validated] SUMO1 Rabbit mAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 10s.](http://images.novusbio.com/fullsize/nbp3-15676_rabbit-sumo1-mab-6f8b6-52202517361210.jpg "Western Blot: SUMO1 Antibody (6F8B6) [SUMO1] - Western blot analysis of lysates from wild type(WT) and SUMO1 knockout (KO) 293T cells, using [KO Validated] SUMO1 Rabbit mAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 10s.")
![Western Blot Butyrylcholinesterase/BCHE Antibody [Unconjugated]](https://images.novusbio.com/images2/Butyrylcholinesterase_AF9024_Western_Blot_19121.jpg)
![Immunohistochemistry Butyrylcholinesterase/BCHE Antibody [Unconjugated]](https://images.novusbio.com/images2/Butyrylcholinesterase_AF9024_Immunohistochemistry_19158.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")