![Western Blot: Phospholipase A2 IID Antibody [NBP2-94062] - Analysis of extracts of various cell lines, using Phospholipase A2 IID at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit . Exposure time: 90s.](http://images.novusbio.com/fullsize/Phospholipase-A2-IID-Antibody-Western-Blot-NBP2-94062-img0005.jpg "Western Blot: Phospholipase A2 IID Antibody [NBP2-94062] - Analysis of extracts of various cell lines, using Phospholipase A2 IID at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit . Exposure time: 90s.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 21-145 of human PLA2G2D (NP_036532.1). GILNLNKMVKQVTGKMPILSYWPYGCHCGLGGRGQPKDATDWCCQTHDCCYDHLKTQGCSIYKDYYRYNFSQGNIHCSDKGSWCEQQLCACDKEVAFCLKRNLDTYQKRLRFYWRPHCRGQTPGC |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | PLA2G2D |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Theoretical MW | 16 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol |
| Preservative | 0.09% Sodium Azide |
| Purity | Affinity purified |
![Western Blot PLA2G2A Antibody [Unconjugated]](https://images.novusbio.com/images2/PLA2G2A_AF4925_Western_Blot_10430.jpg)
![Immunohistochemistry PLA2G2A Antibody [Unconjugated]](https://images.novusbio.com/images2/PLA2G2A_AF4925_Immunohistochemistry_10959.jpg)
![Simple Western PLA2G2A Antibody [Unconjugated]](https://images.novusbio.com/images2/PLA2G2A_AF4925_Simple_Western_17643.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for Phospholipase A2 IID Antibody (NBP2-94062)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | PLA2G2D |
![Immunocytochemistry/Immunofluorescence: Phospholipase A2 IID Antibody [NBP2-94062] - Analysis of MCF7 cells using Phospholipase A2 IID . Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/Phospholipase-A2-IID-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-94062-img0001.jpg "Immunocytochemistry/Immunofluorescence: Phospholipase A2 IID Antibody [NBP2-94062] - Analysis of MCF7 cells using Phospholipase A2 IID . Blue: DAPI for nuclear staining.")
![Immunohistochemistry-Paraffin: Phospholipase A2 IID Antibody [NBP2-94062] - Paraffin-embedded mouse testis using Phospholipase A2 IID .](http://images.novusbio.com/fullsize/Phospholipase-A2-IID-Antibody-Immunohistochemistry-Paraffin-NBP2-94062-img0004.jpg "Immunohistochemistry-Paraffin: Phospholipase A2 IID Antibody [NBP2-94062] - Paraffin-embedded mouse testis using Phospholipase A2 IID .")
![Immunohistochemistry-Paraffin: Phospholipase A2 IID Antibody [NBP2-94062] - Paraffin-embedded human liver cancer using Phospholipase A2 IID .](http://images.novusbio.com/fullsize/Phospholipase-A2-IID-Antibody-Immunohistochemistry-Paraffin-NBP2-94062-img0002.jpg "Immunohistochemistry-Paraffin: Phospholipase A2 IID Antibody [NBP2-94062] - Paraffin-embedded human liver cancer using Phospholipase A2 IID .")
![Immunohistochemistry-Paraffin: Phospholipase A2 IID Antibody [NBP2-94062] - Paraffin-embedded human stomach using Phospholipase A2 IID .](http://images.novusbio.com/fullsize/Phospholipase-A2-IID-Antibody-Immunohistochemistry-Paraffin-NBP2-94062-img0003.jpg "Immunohistochemistry-Paraffin: Phospholipase A2 IID Antibody [NBP2-94062] - Paraffin-embedded human stomach using Phospholipase A2 IID .")
![Simple Western 14-3-3 zeta Antibody (818515) [Unconjugated]](https://images.novusbio.com/images2/1433_zeta_MAB2669_Simple_Western_16526.jpg)
![Western Blot 14-3-3 zeta Antibody (818515) [Unconjugated]](https://images.novusbio.com/images2/14-3-3_zeta_MAB2669_Western_Blot_12700.jpg)
![Immunohistochemistry 14-3-3 zeta Antibody (818515) [Unconjugated]](https://images.novusbio.com/images2/14-3-3_zeta_MAB2669_Immunohistochemistry_12730.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/DATA_IL6_M6000_ELISA_936.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/IL-6_M6000_ELISA_415.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images/m6000b_mouse-il-6-quantikine-elisa-kit-44202415433118.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")