![Western Blot: PLA2G3 Antibody [NBP1-83367] - Analysis in control (vector only transfected HEK293T lysate) and PLA2G3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize/PLA2G3-Antibody-Western-Blot-NBP1-83367-img0005.jpg "Western Blot: PLA2G3 Antibody [NBP1-83367] - Analysis in control (vector only transfected HEK293T lysate) and PLA2G3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: SPPEVTNMLWELLGTTCFKLAPPLDCVEGKNCSRDPRAIRVSARHLRRLQQRRHQLQDKGTDERQPWPSEPLRGPMSFYNQCLQLTQAARRPDRQQKSWSQ |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | PLA2G3 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot PLA2G2A Antibody [Unconjugated]](https://images.novusbio.com/images2/PLA2G2A_AF4925_Western_Blot_10430.jpg)
![Immunohistochemistry PLA2G2A Antibody [Unconjugated]](https://images.novusbio.com/images2/PLA2G2A_AF4925_Immunohistochemistry_10959.jpg)
![Simple Western PLA2G2A Antibody [Unconjugated]](https://images.novusbio.com/images2/PLA2G2A_AF4925_Simple_Western_17643.jpg)
![Neutralization CXCL8/IL-8 Antibody (6217) [Unconjugated]](https://images.novusbio.com/images2/CXCL8_MAB208_Block_Neutralize_9064.jpg)
![Immunocytochemistry CXCL8/IL-8 Antibody (6217) [Unconjugated]](https://images.novusbio.com/images2/CXCL8_MAB208_Immunocytochemistry_9339.jpg)
![Western Blot CXCL8/IL-8 Antibody (6217) [Unconjugated]](https://images.novusbio.com/images2/mab208_human-il-8-cxcl8-mab-clone-6217-western-blot-1882021143847.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for PLA2G3 Antibody (NBP1-83367)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | PLA2G3 |
![Immunohistochemistry-Paraffin: PLA2G3 Antibody [NBP1-83367] - Staining of human skin shows moderate membranous and cytoplasmic positivity in squamous epithelial cells.](http://images.novusbio.com/fullsize/antibody/nbp1-83367_rabbit-polyclonal-pla2g3-antibody-immunohistochemistry-paraffin-267202393536..jpg "Immunohistochemistry-Paraffin: PLA2G3 Antibody [NBP1-83367] - Staining of human skin shows moderate membranous and cytoplasmic positivity in squamous epithelial cells.")
![Immunohistochemistry-Paraffin: PLA2G3 Antibody [NBP1-83367] - Staining of human lung shows strong membranous and cytoplasmic positivity in macrophages.](http://images.novusbio.com/fullsize/antibody/nbp1-83367_rabbit-polyclonal-pla2g3-antibody-immunohistochemistry-paraffin-267202393648..jpg "Immunohistochemistry-Paraffin: PLA2G3 Antibody [NBP1-83367] - Staining of human lung shows strong membranous and cytoplasmic positivity in macrophages.")
![Immunohistochemistry-Paraffin: PLA2G3 Antibody [NBP1-83367] - Staining of human endometrium shows weak membranous and cytoplasmic positivity in glandular cells as expected.](http://images.novusbio.com/fullsize/antibody/nbp1-83367_rabbit-polyclonal-pla2g3-antibody-immunohistochemistry-paraffin-26720239380..jpg "Immunohistochemistry-Paraffin: PLA2G3 Antibody [NBP1-83367] - Staining of human endometrium shows weak membranous and cytoplasmic positivity in glandular cells as expected.")
![Immunohistochemistry-Paraffin: PLA2G3 Antibody [NBP1-83367] - Staining of human skeletal muscle shows no membranous and cytoplasmic positivity in myocytes as expected.](http://images.novusbio.com/fullsize/antibody/nbp1-83367_rabbit-polyclonal-pla2g3-antibody-immunohistochemistry-paraffin-267202393928..jpg "Immunohistochemistry-Paraffin: PLA2G3 Antibody [NBP1-83367] - Staining of human skeletal muscle shows no membranous and cytoplasmic positivity in myocytes as expected.")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")