![Western Blot: PGRMC1 Antibody [NBP1-83220] - Haem-dependent dimerization of PGRMC1 accelerates tumor growth through the EGFR signaling pathway. Nucleotide sequences of PGRMC1 targeted by shRNA and of the shRNA-resistant full length PGRMC1 expression vector. Stable PGRMC1-knockdown (PGRMC1-KD) HCT116 cells were transiently transfected with the shRNA-resistant expression vector of wild-type PGRMC1 (wt) or the Y113F mutant (Y113F). Image collected and cropped by CiteAb from the following publication (//www.nature.com/articles/ncomms11030), licensed under a CC-BY license.](http://images.novusbio.com/fullsize/PGRMC1-Antibody-Western-Blot-NBP1-83220-img0029.jpg "Western Blot: PGRMC1 Antibody [NBP1-83220] - Haem-dependent dimerization of PGRMC1 accelerates tumor growth through the EGFR signaling pathway. Nucleotide sequences of PGRMC1 targeted by shRNA and of the shRNA-resistant full length PGRMC1 expression vector. Stable PGRMC1-knockdown (PGRMC1-KD) HCT116 cells were transiently transfected with the shRNA-resistant expression vector of wild-type PGRMC1 (wt) or the Y113F mutant (Y113F). Image collected and cropped by CiteAb from the following publication (//www.nature.com/articles/ncomms11030), licensed under a CC-BY license.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, Simple Western, ICC/IF, IHC, KD |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: DQPAASGDSDDDEPPPLPRLKRRDFTPAELRRFDGVQDPRILMAINGKVFDVTKGRKFYGPEGPYGVFAGRDASR |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | PGRMC1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | IHC-Paraffin HIER pH6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for PGRMC1 Antibody (NBP1-83220)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | PGRMC1 |
![Immunohistochemistry-Paraffin: PGRMC1 Antibody [NBP1-83220] - Staining in human liver and skeletal muscle tissues . Corresponding PGRMC1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/PGRMC1-Antibody-Immunohistochemistry-Paraffin-NBP1-83220-img0026.jpg "Immunohistochemistry-Paraffin: PGRMC1 Antibody [NBP1-83220] - Staining in human liver and skeletal muscle tissues . Corresponding PGRMC1 RNA-seq data are presented for the same tissues.")
![Western Blot: PGRMC1 Antibody [NBP1-83220] - Analysis in human cell line HEK 293.](http://images.novusbio.com/fullsize/PGRMC1-Antibody-Western-Blot-NBP1-83220-img0014.jpg "Western Blot: PGRMC1 Antibody [NBP1-83220] - Analysis in human cell line HEK 293.")
![Western Blot: PGRMC1 Antibody [NBP1-83220] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.](http://images.novusbio.com/fullsize/PGRMC1-Antibody-Western-Blot-NBP1-83220-img0015.jpg "Western Blot: PGRMC1 Antibody [NBP1-83220] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.")
![Western Blot: PGRMC1 Antibody [NBP1-83220] - Analysis in human liver tissue.](http://images.novusbio.com/fullsize/PGRMC1-Antibody-Western-Blot-NBP1-83220-img0028.jpg "Western Blot: PGRMC1 Antibody [NBP1-83220] - Analysis in human liver tissue.")
![Immunohistochemistry-Paraffin: PGRMC1 Antibody [NBP1-83220] - Staining of human breast cancer shows strong cytoplasmic positivity in tumor cells.](http://images.novusbio.com/fullsize/PGRMC1-Antibody-Immunohistochemistry-Paraffin-NBP1-83220-img0020.jpg "Immunohistochemistry-Paraffin: PGRMC1 Antibody [NBP1-83220] - Staining of human breast cancer shows strong cytoplasmic positivity in tumor cells.")
![Immunohistochemistry-Paraffin: PGRMC1 Antibody [NBP1-83220] - Staining of human endometrium shows moderate to strong cytoplasmic positivity in glandular and stromal cells.](http://images.novusbio.com/fullsize/PGRMC1-Antibody-Immunohistochemistry-Paraffin-NBP1-83220-img0021.jpg "Immunohistochemistry-Paraffin: PGRMC1 Antibody [NBP1-83220] - Staining of human endometrium shows moderate to strong cytoplasmic positivity in glandular and stromal cells.")
![Immunohistochemistry-Paraffin: PGRMC1 Antibody [NBP1-83220] - Staining of human hippocampus shows strong cytoplasmic positivity in neuronal cells.](http://images.novusbio.com/fullsize/PGRMC1-Antibody-Immunohistochemistry-Paraffin-NBP1-83220-img0022.jpg "Immunohistochemistry-Paraffin: PGRMC1 Antibody [NBP1-83220] - Staining of human hippocampus shows strong cytoplasmic positivity in neuronal cells.")
![Immunohistochemistry-Paraffin: PGRMC1 Antibody [NBP1-83220] - Staining of human kidney shows moderate to strong cytoplasmic positivity in cells in tubules.](http://images.novusbio.com/fullsize/PGRMC1-Antibody-Immunohistochemistry-Paraffin-NBP1-83220-img0023.jpg "Immunohistochemistry-Paraffin: PGRMC1 Antibody [NBP1-83220] - Staining of human kidney shows moderate to strong cytoplasmic positivity in cells in tubules.")
![Immunohistochemistry-Paraffin: PGRMC1 Antibody [NBP1-83220] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.](http://images.novusbio.com/fullsize/PGRMC1-Antibody-Immunohistochemistry-Paraffin-NBP1-83220-img0024.jpg "Immunohistochemistry-Paraffin: PGRMC1 Antibody [NBP1-83220] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.")
![Immunohistochemistry-Paraffin: PGRMC1 Antibody [NBP1-83220] - Staining of human skeletal muscle shows no cytoplasmic positivity in myocytes as expected.](http://images.novusbio.com/fullsize/PGRMC1-Antibody-Immunohistochemistry-Paraffin-NBP1-83220-img0025.jpg "Immunohistochemistry-Paraffin: PGRMC1 Antibody [NBP1-83220] - Staining of human skeletal muscle shows no cytoplasmic positivity in myocytes as expected.")
![Simple Western: PGRMC1 Antibody [NBP1-83220] - Simple Western lane view shows a specific band for PGRMC1 in 0.2 mg/ml of RT-4 (left) and U-251MG sp (right) lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.](http://images.novusbio.com/fullsize/PGRMC1-Antibody-Simple-Western-NBP1-83220-img0005.jpg "Simple Western: PGRMC1 Antibody [NBP1-83220] - Simple Western lane view shows a specific band for PGRMC1 in 0.2 mg/ml of RT-4 (left) and U-251MG sp (right) lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.")
![Simple Western: PGRMC1 Antibody [NBP1-83220] - Electropherogram image(s) of corresponding Simple Western lane view. PGRMC1 antibody was used at 1:20 dilution on RT-4 and U-251MG sp lysates(s).](http://images.novusbio.com/fullsize/PGRMC1-Antibody-Simple-Western-NBP1-83220-img0006.jpg "Simple Western: PGRMC1 Antibody [NBP1-83220] - Electropherogram image(s) of corresponding Simple Western lane view. PGRMC1 antibody was used at 1:20 dilution on RT-4 and U-251MG sp lysates(s).")
![Knockdown Validated: PGRMC1 Antibody [NBP1-83220] - Haem-dependent dimerization of PGRMC1 is necessary for tumor proliferation mediated by EGFR signaling. HCT116 cells expressing control shRNA or those knocking down PGRMC1 (PGRMC1-KD) were treated with EGF or left untreated, and components of the EGFR signaling pathway were detected by Western blotting. Image collected and cropped by CiteAb from the following publication (//www.nature.com/articles/ncomms11030), licensed under a CC-BY license.](http://images.novusbio.com/fullsize/PGRMC1-Antibody-Knockdown-Validated-NBP1-83220-img0030.jpg "Knockdown Validated: PGRMC1 Antibody [NBP1-83220] - Haem-dependent dimerization of PGRMC1 is necessary for tumor proliferation mediated by EGFR signaling. HCT116 cells expressing control shRNA or those knocking down PGRMC1 (PGRMC1-KD) were treated with EGF or left untreated, and components of the EGFR signaling pathway were detected by Western blotting. Image collected and cropped by CiteAb from the following publication (//www.nature.com/articles/ncomms11030), licensed under a CC-BY license.")
![Immunocytochemistry Progesterone R/NR3C3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Progesterone_R_AF5415_Immunocytochemistry__Immunofluorescence_20674.jpg)
![Immunohistochemistry Progesterone R/NR3C3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Progesterone_R_AF5415_Immunohistochemistry_20779.jpg)
![Western Blot Progesterone R/NR3C3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Progesterone_R_AF5415_Western_Blot_5715.jpg)
![SDS-PAGE IGF-II/IGF2 [Unconjugated]](https://images.novusbio.com/images2/IGF-II_292-G2_668.jpg)
![Bioactivity IGF-II/IGF2 [Unconjugated]](https://images.novusbio.com/images2/IGF-II_292-G2_669.jpg)
![N/A Adiponectin/Acrp30 [HRP]](https://images.novusbio.com/images2/DATA_Adiponectin_DRP300_ELISA_812.jpg)
![N/A Adiponectin/Acrp30 [HRP]](https://images.novusbio.com/images2/DATA_Adiponectin_DRP300_ELISA_813.jpg)
![N/A Adiponectin/Acrp30 [HRP]](https://images.novusbio.com/images2/Adiponectin_DRP300_ELISA_173.jpg)
![Immunohistochemistry Cathepsin D Antibody [Unconjugated]](https://images.novusbio.com/images2/Cathepsin_D_AF1029_Immunohistochemistry_6668.jpg)
![Immunocytochemistry Cathepsin D Antibody [Unconjugated]](https://images.novusbio.com/images2/Cathepsin_D_AF1029_Immunocytochemistry__Immunofluorescence_23054.jpg)
![Western Blot Cathepsin D Antibody [Unconjugated]](https://images.novusbio.com/images2/Cathepsin_D_AF1029_Western_Blot_19580.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")