PGAP3 Antibody Summary
Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: SQGDREPVYRDCVLQCEEQNCSGGALNHFRSRQPIYMSLAGWTCRDDCKYECMWVTVGLYLQEGHKVPQFHGKWP |
Predicted Species |
Mouse (92%), Rat (91%). Backed by our 100% Guarantee. |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
PGAP3 |
Purity |
Immunogen affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
- Immunohistochemistry 1:20 - 1:50
- Immunohistochemistry-Paraffin 1:20 - 1:50
|
Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
Control Peptide |
|
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Immunogen affinity purified |
Alternate Names for PGAP3 Antibody
Background
The L-type calcium channel is composed of four subunits: alpha-1, alpha-2, beta and gamma. The beta subunit of voltage-dependent calcium channels aids the function of the calcium channel by increasing the peak calcium current, shifting the voltage dependencies of activation and inactivation, modulating G protein inhibition and controlling the alpha-1 subunit membrane targeting. CAB2 is a membrane protein that is expressed in all tissues. The unprocessed precursor is 660 amino acids in length and has a predicted molecular weight of 74.5KDa. It belongs to the calcium channel beta subunit family and contains one SH3 domain. CAB2 is involved in the MAPK signalling pathway and is also associated with Lambert-Eaton myasthenic syndrome.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Am, Hu, Mu, Pm, Rt
Applications: ChIP, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, KO, WB
Species: Hu, Mu
Applications: ChIP, WB
Species: Hu, Mu
Applications: ICC, IHC, WB
Species: Hu
Applications: BA
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Mu
Applications: IHC
Species: Hu
Applications: IHC, IHC-P, WB
Species: Eq, Hu, Mu, Rt
Applications: IHC, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
Species: Hu, Mu, Rt
Applications: ChIP, CHIP-SEQ, ChIP, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, WB
Publications for PGAP3 Antibody (NBP1-86692) (0)
There are no publications for PGAP3 Antibody (NBP1-86692).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for PGAP3 Antibody (NBP1-86692) (0)
There are no reviews for PGAP3 Antibody (NBP1-86692).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for PGAP3 Antibody (NBP1-86692) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional PGAP3 Products
Blogs on PGAP3