![Immunocytochemistry/Immunofluorescence: NPAS2 Antibody [NBP1-88612] - Staining of human cell line A-431 shows localization to nucleoplasm. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/NPAS2-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-88612-img0013.jpg "Immunocytochemistry/Immunofluorescence: NPAS2 Antibody [NBP1-88612] - Staining of human cell line A-431 shows localization to nucleoplasm. Antibody staining is shown in green.")
| Reactivity | HuSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: SKPEFIVCTHSVVSYADVRVERRQELALEDPPSEALHSSALKDKGSSLEPRQHFNTLDVGASGLNTSHSPSASSRSSHKSSHTAMSEPTSTPTKLMAEASTPALPRSATLPQELPVP |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | NPAS2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation/Permeabilization: PFA/Triton X-100 |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot Serotonin N-acetyltransferase [p Thr29] Antibody - BSA Free](https://images.novusbio.com/images/Serotonin-N-acetyltransferase-[p-Thr29]-Antibody-Western-Blot-NB120-3439-img0003.jpg)
| Publication using NBP1-88612 | Applications | Species |
|---|---|---|
| Mosna K, Janega P, Sedlak J, Babal P. Complex changes of circadian proteins expression in inflammatory bowel disease Bratislava Medical Journal 2021-03-17 [PMID: 33729814] (IHC) | IHC |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | NPAS2 |
![Immunohistochemistry-Paraffin: NPAS2 Antibody [NBP1-88612] - Staining of human testis shows moderate nuclear positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/NPAS2-Antibody-Immunohistochemistry-Paraffin-NBP1-88612-img0020.jpg "Immunohistochemistry-Paraffin: NPAS2 Antibody [NBP1-88612] - Staining of human testis shows moderate nuclear positivity in cells in seminiferous ducts.")
![Immunohistochemistry: NPAS2 Antibody [NBP1-88612] - Staining of mouse brain shows moderate positivity of neurons in the cerebral cortex.](http://images.novusbio.com/fullsize/NPAS2-Antibody-Immunohistochemistry-Paraffin-NBP1-88612-img0015.jpg "Immunohistochemistry: NPAS2 Antibody [NBP1-88612] - Staining of mouse brain shows moderate positivity of neurons in the cerebral cortex.")
![Immunohistochemistry-Paraffin: NPAS2 Antibody [NBP1-88612] - Staining of human cerebral cortex shows moderate nuclear positivity.](http://images.novusbio.com/fullsize/NPAS2-Antibody-Immunohistochemistry-Paraffin-NBP1-88612-img0017.jpg "Immunohistochemistry-Paraffin: NPAS2 Antibody [NBP1-88612] - Staining of human cerebral cortex shows moderate nuclear positivity.")
![Immunohistochemistry-Paraffin: NPAS2 Antibody [NBP1-88612] - Staining of human skeletal muscle shows weak nuclear positivity in myocytes.](http://images.novusbio.com/fullsize/NPAS2-Antibody-Immunohistochemistry-Paraffin-NBP1-88612-img0018.jpg "Immunohistochemistry-Paraffin: NPAS2 Antibody [NBP1-88612] - Staining of human skeletal muscle shows weak nuclear positivity in myocytes.")
![Immunohistochemistry-Paraffin: NPAS2 Antibody [NBP1-88612] - Staining of human stomach shows moderate nuclear positivity in glandular cells.](http://images.novusbio.com/fullsize/NPAS2-Antibody-Immunohistochemistry-Paraffin-NBP1-88612-img0019.jpg "Immunohistochemistry-Paraffin: NPAS2 Antibody [NBP1-88612] - Staining of human stomach shows moderate nuclear positivity in glandular cells.")
![Immunocytochemistry CRY1 Antibody [Unconjugated]](https://images.novusbio.com/images2/CRY1_AF3764_Immunocytochemistry__Immunofluorescence_19530.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")