Home » OXPAT » OXPAT Proteins » OXPAT Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

OXPAT Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for OXPAT Recombinant Protein Antigen (NBP3-17192PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

OXPAT Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human OXPAT

Source: E. coli

Amino Acid Sequence: GPFAPILVERPEPLPDLADLVDEVIGGPDPRWAHLDWPAQQRAWEAEHRDGSGNGDGDRMGVAGDICEQEPETPSCPVKHTLMPELD

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PLIN5
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-17192.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for OXPAT Recombinant Protein Antigen

  • lipid storage droplet protein 5
  • LSDA5
  • LSDP5
  • MLDP
  • OXPAT
  • perilipin 5
  • perilipin-5

Background

OXPAT is a novel PAT-1 protein that is expressed in highly oxidative tissues. Lipid droplet proteins of the PAT family regulate cellular neutral lipid stores. OXPAT is induced by physiological (fasting), pathophysiological (insulin deficiency), pharmacological (peroxisome proliferator-activated receptor [PPAR] agonists), and genetic (muscle-specific PPAR alpha overexpression) disturbances that increase fatty acid utilization. It is suggested that OXPAT is a marker for PPAR activation and fatty acid oxidation. OXPAT may also contribute to adaptive responses to the fatty acid responsibility that accompanies fasting, insulin deficiency, and overnutrition responses that are defective in obesity and type 2 diabetes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Perilipin-2/ADFP
Antibody - BSA Free
NB110-40877
Immunohistochemistry Perilipin-2/ADFP Antibody - BSA Free
Dual RNAscope ISH-IHC Perilipin-2/ADFP Antibody - BSA Free
Western Blot Perilipin-2/ADFP Antibody - BSA Free
(1 Review)
(64 Publications)
Species: Bv, Hu, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Perilipin Antibody
NB110-40760
Flow Cytometry Perilipin Antibody
Flow Cytometry Perilipin Antibody
Imaging Mass Cytometry Perilipin Antibody
(1 Review)
(16 Publications)
Species: Fi, Hu, Mu, Po, Rt
Applications: Flow, IMC, ICC/IF, IHC, IHC-P, WB
Perilipin-3/TIP47
Antibody
NB110-40764
Western Blot Perilipin-3/TIP47 Antibody
Western Blot Perilipin-3/TIP47 Antibody
Immunocytochemistry/ Immunofluorescence Perilipin-3/TIP47 Antibody
(17 Publications)
Species: Hu, Mu, Po, Pm
Applications: ICC/IF, WB
PEDFR/PNPLA2/ATGL
Antibody [Unconjugate ...
AF5365
Western Blot PEDFR/PNPLA2/ATGL Antibody [Unconjugated]
Simple Western PEDFR/PNPLA2/ATGL Antibody [Unconjugated]
Immunohistochemistry PEDFR/PNPLA2/ATGL Antibody [Unconjugated]
(10 Publications)
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
Perilipin-4
Antibody
NBP2-13776
Immunohistochemistry-Paraffin Perilipin-4 Antibody
Immunohistochemistry-Paraffin Perilipin-4 Antibody
Immunohistochemistry-Paraffin Perilipin-4 Antibody
(1 Review)
(6 Publications)
Species: Hu, Mu, Po
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
FMN1 Antibody (4F4)
H00342184-M07
ELISA FMN1 Antibody (4F4)
Immunocytochemistry/ Immunofluorescence FMN1 Antibody (4F4)
Western Blot FMN1 Antibody (4F4)
Species: Hu
Applications: ELISA, ICC/IF, WB
FoxC2 Antibody
AF6989
Immunohistochemistry FoxC2 Antibody
Immunohistochemistry FoxC2 Antibody
Immunohistochemistry FoxC2 Antibody
(27 Publications)
Species: Mu
Applications: IHC
PPAR gamma/NR1C3
Antibody - BSA Free
NBP2-22106
Western Blot PPAR gamma/NR1C3 Antibody - BSA Free
Immunohistochemistry-Paraffin PPAR gamma/NR1C3 Antibody - BSA Free
Western Blot PPAR gamma/NR1C3 Antibody - BSA Free
(2 Reviews)
(11 Publications)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Abhd5 Antibody
(1F3)
H00051099-M01
Western Blot Abhd5 Antibody (1F3)
Western Blot Abhd5 Antibody (1F3)
ELISA Abhd5 Antibody (1F3)
(1 Review)
(33 Publications)
Species: Bv, Hu, Pm, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, KO, WB
PPAR alpha/NR1C1
Antibody (3B6/PPAR) - ...
NB300-537
Flow Cytometry PPAR alpha/NR1C1 Antibody (3B6/PPAR) - BSA Free
Western Blot PPAR alpha/NR1C1 Antibody (3B6/PPAR) - BSA Free
Flow Cytometry PPAR alpha/NR1C1 Antibody (3B6/PPAR) - BSA Free
(1 Review)
(16 Publications)
Species: Bv, Hu, Mu, Rb, Rt
Applications: ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, KD, WB
Adiponectin/Acrp30
[HRP]
DRP300
N/A Adiponectin/Acrp30 [HRP]
N/A Adiponectin/Acrp30 [HRP]
N/A Adiponectin/Acrp30 [HRP]
(186 Publications)
Species: Hu
Applications: ELISA
SREBP1 Antibody
(2A4) - BSA Free
NB600-582
Western Blot SREBP1 Antibody (2A4) - BSA Free
Knockout Validated SREBP1 Antibody (2A4) - BSA Free
Western Blot SREBP1 Antibody (2A4) - BSA Free
(66 Publications)
Species: Ca, Ch, SyHa, Ha, Hu, Pm, Mu, Rt
Applications: IHC-Fr, KO, Simple Western, WB
Hormone-sensitive
Lipase/HSL Antibody
NB110-37253
Western Blot Hormone-sensitive Lipase/HSL Antibody
(5 Publications)
Species: Hu, Mu, Rt
Applications: WB
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Immunocytochemistry Insulin Antibody (182410) [Unconjugated]
Immunohistochemistry Insulin Antibody (182410) [Unconjugated]
(24 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Leptin/OB [HRP]
DLP00
N/A Leptin/OB [HRP]
N/A Leptin/OB [HRP]
(155 Publications)
Species: Hu
Applications: ELISA
OXPAT Recombinant
Protein Antigen
NBP3-17192PEP
OXPAT Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for OXPAT Recombinant Protein Antigen (NBP3-17192PEP) (0)

There are no publications for OXPAT Recombinant Protein Antigen (NBP3-17192PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for OXPAT Recombinant Protein Antigen (NBP3-17192PEP) (0)

There are no reviews for OXPAT Recombinant Protein Antigen (NBP3-17192PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for OXPAT Recombinant Protein Antigen (NBP3-17192PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional OXPAT Products

Research Areas for OXPAT Recombinant Protein Antigen (NBP3-17192PEP)

Find related products by research area.

Blogs on OXPAT.

Check out the latest blog posts on OXPAT.
OXPAT: Regulating Lipid Metabolism during Dietary Fluctuations
OXPAT is the mammalian form of the PAT (perilipin, adipophilin, and TIP47) gene family that consists of proteins associated with lipid droplets (LDs) in fat-storing adipocyte cells. They serve to protect LDs from natural lipases responsible for breaki...  Read full blog post.
Read our latest blog and use the new citation tool on bio-techne.com

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our OXPAT Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol PLIN5