Novus Biologicals products are now on bio-techne.com

NLRP2/NALP2 Recombinant Protein Antigen

Images

 
There are currently no images for NLRP2/NALP2 Protein (NBP1-85553PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

NLRP2/NALP2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NLRP2.

Source: E. coli

Amino Acid Sequence: EVDKADGKQLVEILTTHCDSYWVEMASLQVFEKMHRMDLSERAKDEVREAALKSFNKRKPLSLGITRKERPPLDVDEMLERFKTEAQAFTETKGNVI

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
NLRP2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85553.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.

Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for NLRP2/NALP2 Recombinant Protein Antigen

  • CLR19.9
  • FLJ20510
  • NACHT, leucine rich repeat and PYD containing 2
  • NACHT, LRR and PYD domains-containing protein 2
  • NALP2
  • NALP2NACHT, LRR and PYD containing protein 2
  • NBS1
  • NBS1PYRIN-containing APAF1-like protein 2
  • NLR family, pyrin domain containing 2
  • NLRP2
  • nucleotide-binding oligomerization domain, leucine rich repeat and pyrin domaincontaining 2
  • PAN1
  • PAN1Nucleotide-binding site protein 1
  • PYPAF2
  • PYPAF2PYRIN domain and NACHT domain-containing protein 1

Background

NLRP2/NALP2, aka PAN1 and PYPAF2, belongs to a cytoplasmic proteins family containing a NACHT domain, leucine rich repeat (NLR) and N-terminal pyrin-containing domain (PYD). As an intracellular pathogen-recognition receptors (PRRs), NLRP2/NALP2 is a 1062 amino acid protein associated in cell responses to apoptotic and inflammatory stimuli. PRRs are key components of immune systems involving in an innate effector mechanisms and activation of adaptive immunity. By interacting with ASC in addition to CARD8 and caspase 1, NLRP2/NALP2 forms an inflammasome functioning as a modulator of NF-kB and procaspase-1 activation in macrophages. Similar to TLRs, activation of the inflammasome by NLRs occurs through the recognition of pathogen-associated molecular patterns (PAMPs) through their LRR domains. NLRP2/NALP2 expressions varies in several human tumor cell lines though the highest were found in MDA-MB-435 and MCF-7 breast cancer, UACC62 melanoma, and Caco2 colon cancer cells.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-143
Species: Ha, Hu, Ma, Mu, Pm
Applications: ChIP, ChIP, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP, ISH, KD, KO, PAGE, WB
AF1085
Species: Mu
Applications: IHC, Neut, WB
NB100-147
Species: Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, In vitro, KD, WB
NB100-309
Species: Hu, Pm, Mu, Rt
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, KD, PAGE, Single-Cell Western, WB
AF1626
Species: Hu
Applications: ICC, WB
AF2288
Species: Hu
Applications: ICC, IHC, Simple Western, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NB100-598
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IP, WB
NB100-308
Species: Hu, Mu
Applications: Func, ICC/IF, IP, In vitro, KO, WB
NBP2-03417
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
NB100-56585
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-464
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
NB100-304
Species: Bt, Bv, Ca, Fi, Gt, Hu, Mu, Pm, Rt
Applications: ChIP, ChIP, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ISH, KD, KO, WB
NB100-148
Species: Ch, Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, KD, PLA, WB
NB100-395
Species: Hu, Mu
Applications: ICC/IF, IP, WB
NBP1-80992
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-22128
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NB100-79810
Species: Hu, Mu
Applications: ICC/IF, IP, WB
MAB2476
Species: Hu
Applications: IHC, WB
NBP1-85553PEP
Species: Hu
Applications: AC

Publications for NLRP2/NALP2 Protein (NBP1-85553PEP) (0)

There are no publications for NLRP2/NALP2 Protein (NBP1-85553PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NLRP2/NALP2 Protein (NBP1-85553PEP) (0)

There are no reviews for NLRP2/NALP2 Protein (NBP1-85553PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for NLRP2/NALP2 Protein (NBP1-85553PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NLRP2/NALP2 Products

Research Areas for NLRP2/NALP2 Protein (NBP1-85553PEP)

Find related products by research area.

Blogs on NLRP2/NALP2

There are no specific blogs for NLRP2/NALP2, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Nbs1 Antibody
NB100-143

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our NLRP2/NALP2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol NLRP2